Feeds:
Pos
Komentar

Archive for the ‘Budaya’ Category

Tampil dengan kostum yang kontras sebatas dada dihiasi make up yang medhok-merok dan bau parfum yang menyengat hidung, kemudian berlenggang-lenggok di atas gelaran tikar merupakan ciri khas sripanggung pertunjukan tayub. Masyarakat Grobogan menyebutnya sebagai ledhek. Mereka tampil jika diundang oleh warga desa yang kebetulan punya hajat, entah itu khitanan maupun resepsi perkawinan.

Keberadaan ledhek di tengah-tengah masyarakat Grobogan yang mayoritas hidup dalam lingkungan agraris nyaris menyaingi seni hiburan lain semacam wayang kulit, wayang orang, atau ketoprak. Seni tayub masih diuri-uri meski hiburan berbau elektronik sejenis video juga muncul scara sporadis jika kebetulan ada warga desa yang punya hajat. Apakah ini merupakan kompensasi warga desa yang haus hiburan di sela-sela rutinitas pekerjaan bertaninya yang membelenggu ataukah memang telah kadung menjadi tradisi yang mengilus-sumsum sehingga kalau ditinggalkan ada gendam yang musti ditanggung?

Seremoni Nazar
Konon, dulu seni tayub hanyalah sebuah tontonan perlengkapan seremoni nazar bagi warga desa yang kebetulan punya uni alaias nazar. Masyarakat Grobogan meyakini adanya mitos, jika pernah punya nazar, tetapi tidak segera dilaksanakan setelah niatnya tercapai, maka yang bersangkutan akan dirundung malapetaka. Misalnya, ada anggota keluarga yang sakit parah, bahkan sampai meninggal dunia atau dapat pula berubah musibah fatal yang lain. Sebagai medium pengabulan nazar, diundanglah ledhek untuk menolak musibah yang bakal datang. Selain itu, juga sebagai pengucapan rasa syukur kepada Hyang Widhi atas niat dan maksudnya yang telah terkabul. Lama pertunjukan cukup singkat sekitar 1-2 jam. Konon, mantra-mantra yang diucapkan sang ledhek itulah yang sanggup meredam segala musibah.

Dengan iringan gamelan yang mengalun, sang ledhek mulai mengucapkan matra dalam bentuk tembang. Ada suasana sakral di sana. Di tengah asap dupa yang membubung dengan segenap uba rapenya semacam ayam panggang, keris, onggokan pisang, ketupat, dan beras putih, sang ledhek tak henti-hentinya mengucapkan mantra sambil menyebar beras putih ke segala penjuru sebagai tulak balak: “…ana sengkala saka kulon tinulak bali mangulon. Sing nulak balak Raja Iman Slamet …” (ada musibah dari barat ditolak kembali ke barat. Yang menolak Raja Iman Selamat) ….” Byur! Beras putih disebar ke arah barat. Demikian seterusnya higga tujuh kali sesuai dengan arah yang disebutkan. Setelah sang ledhek selesai mengucapkan mantra dalam bentuk tembang, tamatlah pertunjukan sebagai pertanda bahwa nazar telah dilaksanakan. Mereka yakin, musibah tak mungkin muncul sekaligus sang empunya nazar terhindari dari segala petaka.

Namun, seirama perkembangan seni hiburan di daerah pelosok pedesaan, seni tayub kini berubah fungsi, suasana, dan temponya. Dari fungsinya sebagai perlengkapan seremonial nazar beralih fungsi sebagai hiburan semata. Suasana sakral pun sirna berganti suasana hingar-bingar di tengah musik gamelan yang membubung ditingkah ketipak kendang yang keras membentak. Tempo pertunjukannya pun berlangsung semalam suntuk alias byar klekar seperti hiburan lain pada umumnya.
 
Seronok
Tayub, konon merupakan jarwa-dhosok (akronim) “Yen ditata dadi guyub” (kalau ditata jadi guyup/rukun). Ada makna harfiahnya. Pertunjukan tayub yang melibatkan ± lima pria sebagai penayub dengan dua atau tiga ledhek sebagai sripanggungnya, kalau ditata dan diatur nyaris mampu menampilkan suasana paguyuban yang kuyup akan nilai persaudaraan, kerukunan, dan kekeluargaan. Namun, toh akhirnya makna harfiah yang kuyup nilai itu jadi sirna lantaran dibikin sendiri oleh ulah penayubnya yang kadang seronok, hampir-hampir menjurus ke tingkah pornografi.

Lazimnya, pertunjukan dimulai pukul 21.00 didahului dengan pembukaan instrumen gamelan para niyaga. Setelah semuanya siap, sang ledhek mulai memburu mangsa yang duduk di ruang tamu. Biasanya, mangsa (baca: penayub) yang ketiban smapur atau diberi selendang oleh ledheknya memberi imbalan Rp500. pertunjukan dibagi dalam 2 tahap, yakni mulai pukul 21.00 hingga pukul 24.00 giliran pinisepuh dan warga yang tergolong usia tua dan mulai pukul 0.00 dini hari hingga selesai giliran anak-anak muda. Jika diamati, pada tahap kedualah yang paling gempar.

Boleh dibilang bahwa pada tahap ini pertunjukan mencapai puncak ekstasenya. Nyaris tak ada batas antara penonton dan para penayub. Mereka sama-sama lebur dalam suasana yang hingar-bingar. Semakin larut malam, penonton kian meruah dengan tepuk sorak yang membahana. Pada tahap kedua ini, cara menayub terbagi dalam dua teknik, yakni menari dan ngepos.

Bagi para pemuda yang terampil menari, mereka memilih cara yang pertama dengan mengundang teman-temannya –istilahnya sambatan—untuk bersama-sama menari di tengah pertunjukan. Mereka bebas memilih gending-gending Jawa yang keras dan hingar-bingar dengan suara hentakan kendang yang cukp dominan, seperti gumbul thek, kijing miring, godril, celeng mogok, goyang semarang, dan semacamnya. Sambil menari, mereka mulai bertingkah. Tubuhnya mulai menghimpit, memeluk, bahkan mencium. Penonton dari semua tingkatan usia pun bersorak tempik. Mereka bergumul tanpa malu-malu, meski dilihat oleh sanak saudara dan kerabatnya. Barangkali ini sebagai kompensasi bagi para pemuda desa yang haus hiburan di sela-sela rutinitas kesehariannya yang maton.tanpa variasi.

Sedangkan, bagi para pemuda yang tak becus menari, cukup dengan ngepos, yakni duduk di kursi panjang sambil memangku sang ledhek. Mereka mirip benar dnegan insan manusia yang tengah dimabuk asmara. Dengan diiringi gending-gending Jawa yang rata-rata halus-romantis, semacam sida asih, lara branta, rujak jeruk, yen ing tawang ana lintang, dan sebagainya, mereka mulai bertingkah seronok seolah-olah benar-benar ingin melampiaskan rupa birahinya yang menggelora.

Bisa dipastikan, bila ada orang punya hajat, jauh-jauh hari mereka mengumpulkan uang. Memang beginikah sikap para pemuda desa dalam upaya menyiasati kepekaan rohani dan kodrati terhadap hiburan di abad gelombang informasi ini? Ya, barangkali memang ini merupakan siasat guna mengentaskan diri dari himpitan zaman yang menelikungnya.
 
Tanpa Beban Dosa
Ledhek, konon merupakan jarwa-dhosok dari “Elek ben angger gelem medhek-medhek” (biar jelek asal mau mendekat). Seperti kebanyak ledhek di daerah kabupaten Grobogan, modal kecantikan tak begitu penting, meski juga berpengaruh dalam hal pemasaran. Modalnya cukup dengan dandanan yang seronok dengan vokal yang lancar selama semalam suntuk ditambah dengan keberanian mendekati kaum lelaki. Dan, agaknya mereka tampil seperti layaknya menawarkan kodrat profesi, tanpa merasa dihimpit beban dosa.

Pekerjaan, apa pun bentuk dan macamnya, kalau sudah cocok dengan kehendak nurani, memang kadang-kadang tak pandang soal etika. Kalau memang pekerjaan semacam yang dilakukan oleh Tukiyem itu sudah menjadi tuntutan nuraninya, dapatlah ia dijadikan sebagai tameng pendobrak kehidupan yang kian sulit seperti sekarang ini, meski ada bias-bias tuntutan moral di sana. Para ledhek dalam kehidupan sehari-harinya pun hidup wajar bersama warga yang lain, tanpa ada beban moral yang mesti ditanggung.

Ledhek barangkali bisa disamakan dengan keberadaan cokek di Sragen, atau tandak di Surabaya yang diterjuni secara wajar-wajar saja tanpa adanya perangkat upacara perangkat penobatan. Akan tetapi, berbeda dnegan ronggeng di daerah Banyumas yang mengenal adanya tradisi bukak klambu, yang harus rela menyerahkan kehormatannya sebelum dinobatkan sebagai ronggeng. Ledhek di Grobogan, seperti layaknya profesi yang lain, diterjuni secara wajar-wajar saja. Asal ada niat dan sanggup, meluncurlah mereka ke tengah-tengah masyarakat sebagai ledhek.

Namun begitu, mengintip pertunjukan tayub Grobogan yang rata-rata menampilkan adegan seronok, perlu diadakan garis kebijaksanaan yang tegas dari pihak yang berwenang, mengingat pertunjukan ini ditonton oleh seluruh lapisan masyarakat tanpa mengenal tingkatan usia. Hal ini bisa menimbulkan dampak negatif yang lebih runyam jika tidak segera mendapatkan uluran kebijakan. Apa kata anak-anak jika melihat sanak saudaranya bergumul bersama ledhek tanpa ada jarak yang memisahkan. Para orang tua seolah meneladani anak-anaknya dengan petingkah yang seronok.

Beranjak dari sisi ini, haruskah pertunjukan tayub yang nyaris hanya memburu segi tontonan dan menihilkan unsur tuntunan, mesti diuri-uri? Ya, perlu ada penegasan yang manusiawi tanpa menyinggung perasaan dan harkat warga desa yang rata-rata lugu dan polos. Paling tidak, jarak antara ledhek dan penayub perlu dibatasi. ***

Read Full Post »

Akhirnya, dunia mengakui batik sebagai produk budaya Indonesia. Unesco mengukuhkan batik ke dalam daftar representatif budaya tak benda warisan manusia atau Representative List of Intangible Cultural Heritage. Pengukuhan ini jelas menjadi kebanggaan tersendiri buat bangsa kita setelah melalui berbagai macam cara, negeri jiran, Malaysia, berupaya mengklaim sebagai produk budaya mereka.

batikbatikbatikbatikMeski demikian, kita tidak cukup hanya berpuas diri pasca-pengukuhan di Abu Dhabi, Uni Emirat Arab, 2 Oktober 2009 itu. Batik tak cukup hanya dilestarikan, tetapi juga perlu terus ditumbuhkembangkan sesuai dengan tuntutan dan dinamika zaman. Dengan kata lain, batik tak hanya berhenti sebatas produk warisan budaya belaka, tetapi juga perlu terus mampu beradaptasi sesuai dengan gerak dan dinamika masyarakat pemakainya.

Dalam perspektif budaya, batik mengandung nilai filosofis yang cukup tinggi, baik dari sisi motif, cara pembuatan, hingga lamanya proses membuat selembar kain batik. Batik menyimbolkan doa dan harapan bagi pemakainya. Bukan hanya itu. Batik juga menunjukkan hasil jerih payah dan kesabaran pembuatnya.

Kurator Museum Batik Jogjakarta, Prayoga, menyatakan, tidak semua penggemar batik paham akan konsep dan filosofi di balik pembuatan kain batik. Pembuat kain batik, lanjutnya, harus dalam kondisi tenang saat membatik. Tak heran, beberapa pembatik harus berpuasa sebelum membatik. “Membatik itu butuh ketenangan. Kita tidak boleh membatik jika sedang gelisah karena akan berpengaruh langsung kepada kain yang kita batik,” tuturnya.

Membatik juga membutuhkan kesabaran dan disiplin ekstra. Dalam satu lembar kain batik, butuh beberapa kali tahap pewarnaan sebelum batik siap dipakai. “Bisa 17 kali kalau memang rumit. Dan, itu memakan waktu. Karena itu, kadang satu batik bisa dibuat hingga satu tahun,” ujarnya.

Kedisiplinan, lanjutnya, ditunjukkan dengan jumlah takaran malam yang pas. “Saat akan membatik, kita harus menakar penggunaan malam dengan pas. Tidak boleh lebih dan tidak boleh kurang. Jika pekerjaan kita tidak selesai, entah itu malamnya kurang atau berlebih, berarti ada yang salah dengan kita,” kata pria berusia 55 tahun ini.

Dalam budaya masyarakat Jawa, kain batik tidak hanya digunakan untuk sandang atau pakaian. Batik menunjukkan prestise dan berfungsi mengungkapkan sesuatu. “Zaman dahulu, kalau anak laki-laki mau melamar, dia harus membawa kain batik dengan motif tertentu kepada orang tua si gadis. Dia tinggal menyerahkan dan orang tua langsung tahu apa maksudnya,” terangnya.

Dalam perspektif budaya Jawa, setiap motif batik memiliki kandungan makna yang berbeda-beda.
1.Batik Parang atau lereng menurut pakemnya hanya boleh digunakan oleh sentono dalem (anak dari ratu). Lereng berasal dari kata mereng (lereng bukit). Sejarah motif ini diawali ketika terjadi pelarian keluarga kerajaan dari Kraton Kartasura. Para keluarga raja terpaksa bersembunyi di daerah pegunungan agar terhindar dari bahaya.

2. Jenis batik truntum dipakai saat seseorang menggelar pesta hajatan. Motif truntum sendiri ditemukan oleh Istri dari Pakubuwana V. Saat itu beliau sedang menjalani hukuman karena melanggar peraturan kerajaan. Pada suatu malam beliau merenung dan memandangi langit berbintang yang ada di angkasa kemudian beliau menuangkan apa yang dia lihat dengan chanthing sehingga menjadi motif batik truntum.

3. Batik sidamukti dipakai oleh pasangan pengantin. Sidamukti sendiri melambangakan sebuah harapan, jadi seketika sepasang pengantin menggunakan kain sidamukti, maka muncul keinginan untuk mencapai kehidupan baru yang berhasil atau dalam bahasa jawa disebut mukti.

4. Batik sido drajad dipakai oleh besan ketika upacara pernikahan. Cara pemakaian batik juga memiliki nilai pendidikan tersendiri, berikut adalah beberapa uraian dari cara pemakaian kain batik. Bagi anak-anak batik dipaki dengan cara sabuk wolo. Pemakaian jenis ini memungkinkan anak-anak untuk bergerak bebas. Secara filosofis pemakaian sabuk wolo diartikan bebas moral, sesuai dengan jiwa anak-anak yang masih bebas dan belum dewasa dan belum memiliki tanggungjawab moral di dalam masyarakat. Ketika beranjak remaja maka seseorang tidak lagi mengenakan batik dengan cara sabuk wolo melainkan dengan jarit. Panjang jarit yang dipakai memiliki arti tersendiri. Seamakin pajang jarit maka semakin tinggi derajad seseorang dalam masyarakat semakin pendek jarit maka semakin rendah pula strata sosial orang tersebut dalam masyarakat.

Bagi dewasa pemakaian batik memiliki pakem tersendiri antara laki-laki dan perempuan. Pada laki-laki wiru diletakkan di sebelah kiri. Sedangkan pada wanita wiru diletakkan di sebelah kanan, yang berarti nengeni. Artinya seorang putri tidak boleh melanggar khendak suami.

Semoga pengukuhan batik oleh Unesco terus mengilhami para perajin batik untuk terus melakukan inovasi dan mengembangkan kreativitasnya dalam menciptakan motif-motif batik yang sesuai dengan tuntutan dan dinamika zaman, hingga akhirnya tak ada negeri lain yang bisa mengklain batik sebagai produk budaya mereka. ***

Read Full Post »

Jumat, 25 September 2009, saya mendapatkan kehormatan menerima kedatangan Mas Khika. Ini untuk yang kedua kalinya bloger yang tengah getol mengelola taman baca itu menyambangi gubug saya. Kedatangan yang pertama terjadi sekitar bulan Maret 2009 yang lalu.

Ketika saya mudik beberapa hari sebelumnya, lelaki muda yang masih suka mengembara di sela-sela rutinitas kesehariannya di dunia IT itu memang sempat kontak saya melalui HP. Dia mengabarkan kalau dia sudah berada di Batang, sebuah kota yang bertetangga dekat dengan Kendal. Seperti biasanya, saya mengharapkan Mas Khika untuk bermain ke Kendal jika ada waktu. Alhamdulillah, bloger yang selama ini bermukim di Bogor itu akhirnya benar-benar datang ke gubug saya.

KhikaKhikaKarena masih harus melanjutkan perjalanan ke Batang, Mas Khika tak bisa berlama-lama ngobrol dengan saya, apalagi keesokan harinya, dia akan menyempatkan diri untuk datang ke markas Jogloabang yang tengah punya hajat menggelar acara halal-bihalal, yang kemudian hendak diteruskan untuk bertemu dengan Mas Totok Sugiarto di puncak Gunung Kelir. Sebelum kabar ini saya sampaikan kepada Mas Khika, saya memang sempat di-sms Mas Ciwir perihal hajat itu. Saya diundang untuk bisa datang ke markas Demang Suryaden itu. Sang Bayang pun juga sempat kontak saya lewat telepon untuk memastikan bisa tidaknya saya datang dalam momen silaturahmi lebaran di Sleman itu.

JogloabangNamun, dengan berat hati, saya tidak bisa ikut hadir dalam acara yang sesungguhnya sudah lama saya nantikan itu. Bagi saya, Jogloabang saya nilai punya daya pesona dan aura tersendiri. Para penggiat Jogloabang, selain menjadi pioner penggunaan software open source, juga amat peduli terhadap perkembangan lingkungan pedesaan yang selama ini memang telah menjadi “mazab” dalam web komunitasnya. Mohon maaf Mas Suryaden, Mas Ciwir, dan sahabat-sahabat bloger Jogloabang atas ketidakhadiran saya dalam momen silaturahmi yang amat menjanjikan nilai keakraban dan kekeluargaan itu. Mohon dimaklumi, antara 26-29 September ini, saya tidak bisa meninggalkan rumah. Kebetulan saja, tetangga sebelah yang sangat dekat dengan saya dan keluarga, pada 28 September nanti sedang punya hajat mantu. Saya dan keluarga didaulat untuk ikut membantu menyiapkan segala sesuatunya. Kemudian, keesokan harinya, gubug saya jadi tempat pelaksanaan halal-bihalal keluarga besar SMP 2 Pegandon, tempat saya mengajar selama ini.

Obrolan semacam itulah yang saya sampaikan kepada Mas Khika yang tampak begitu bersemangat untuk datang ke Jogloabang.

“Apa tidak kontak dulu ke Mas Suryaden, Mas Khika?” tanya saya.

“Itu yang selalu saya hindari, Pak. Biar ada surprise, hehe …. Apalagi, kalau saya ngobrol dengan Suryaden dan Senoaji…” jawab Mas Khika.

Loh, memangnya kenapa?”

“Ndak pernah bisa akur, Pak, hehe …. Selalu saja ndak ada yang mau ngalah, wakakaka …” selorohnya.

“Walah!”

Meski pertemuan saya dengan Mas Khika cukup singkat, tapi selalu menjanjikan geliat persaudaraan dan keakraban. Bisa jadi, inilah salah satu manfaat ngeblog. Punya banyak sahabat dan saudara. Ke mana-mana hanya tinggal meninggalkan pesan lewat chat, FB, email, atau sms.

Saya pun tak sanggup menahan kepergian Mas Khika yang masih harus melanjutkan perjalanannya ke Batang, ke kampung kelahirannya itu. Ok, Mas Khika, selamat berkelana, semoga lancar dan selamat! ***

Read Full Post »

ubuntu1Ternyata ada untungnya juga jadi orang nekad. Nekad untuk bisa secepatnya terlepas dari cengkeraman perangkat lunak berharga setinggi langit dari sang jendela yang bertahun-tahun lamanya telah melahirkan jamaah pembajak. Ya, ya, ya, harga produk-produk microsoft yang terbilang mahal, disadari atau tidak, justru telah membuka peluang pembajakan perangkat lunak sebagai sebuah budaya. Orang merasa tidak risih ketika perangkat lunak yang digunakan sejatinya merupakan produk tak halal dan nyata-nyata telah melanggar hak cipta.

Dalam kondisi demikian, sungguh sebuah terobosan yang menarik apabila penggunaan software open source terus digalakkan, utamanya kalangan kelas menengah ke bawah yang selama ini telah ikut terperangkap dalam sebuah imperium penjajahan yang “dengan sengaja” dilakukan oleh kaum pemilik modal.

Setelah nekad dan terus “terprovokasi” oleh beberapa teman yang sudah terlebih dahulu melenggang memaknai kebebasan dengan menggunakan perangkat lunak open-source, akhirnya saya berhasil juga melakukan migrasi. Pilihan jatuh pada software Ubuntu 9.04 yang menggunakan codename “Jaunty Jackalope”. Sebagai pengguna baru, pemilihan perangkat lunak itu bukan lantaran saya bisa membandingkan kelebihan dan kekurangan sebuah software, melainkan semata-mata nekad saja. Penginstalan Ubuntu 7.10 Gutsy Gibbon pernah memberikan pengalaman buruk buat pengguna perangkat IT yang gaptek seperti saya. Saya terpaksa beralih ke jendela karena fitur dan fasilitas yang ditawarkan belum sepenuhnya mendukung kinerja PC saya, mulai driver sound, video, printer, dan perangkat lunak yang lain.

Ubuntu 9.04 Jaunty Jackalope benar-benar mengubah pandangan saya tentang software open-source. Fitur dan perangkat yang ditawarkan sungguh membuat saya jatuh cinta. Ia tidak saja membebaskan saya dari mitos pembajakan, tetapi juga membuat saya bebas menikmati kemudahan-kemudahan dalam menginstal perangkat pendukung sistem operasi di netbook yang saya gunakan. Melalui terminal, synaptic, update manager, atau add/remove, saya bisa dengan mudah menginstalasi perangkat pendukung kinerja komputer. Kemudahan ini juga saya peroleh berkat “kemauan baik” sahabat-sahabat pengguna open source yang mau membangun semangat berbagi dan share dalam mengoptimalkan kinerja sofware open source dalam sistem operasi komputer. Saya bisa dengan mudah menemukan tulisan dan tutorial open source itu lewat search-engine.

Terima kasih para sahabat pengguna linux yang telah membuka mata fisik dan batin saya untuk tidak terus-terusan terperangkap dalam mitos pembajakan perangkat lunak dari tahun ke tahun. ***

Read Full Post »

Entah, produk budaya Indonesia apa lagi yang hendak dicaplok negeri Jiran. Yang pasti, hingga saat ini, sudah ada puluhan produk budaya kita yang nyata-nyata telah diklaim dan dipatenkan oleh sebuah negara kecil yang konon tak pernah merasakan etos perjuangan dan buta kebudayaan itu. Bagaimana tidak? Malaysia tak se-heroik Indonesia dalam berjuang merebut dan mempertahankan eksistensi negara-bangsa. Untuk mempertahankan dan merebut eksistensi negara yang merdeka dan berdaulat penuh, Indonesia mesti berdarah-darah dan mengorbankan segalanya. Lain halnya dengan Malaysia. Mereka bisa hidup makmur karena proteksi dan belas kasihan negara lain yang dulu menjajahnya. Semua kemanjaan mereka dapatkan secara instan. Tak heran apabila Malaysia ktak pernah bisa menghargai karya cipta dan kreativitas bangsa serumpun. Mereka juga tak pernah mengenal dan mengasah kepekaan kultural. Karena tak pernah mengenal dinamika berkesenian dan berkebudayaan, merka hanya bisa menjiplak, main klaim, mencuri, dan main caplok.

Ironisnya, pemerintah kita seperti tutup mata dan tutup telinga terhadap ulah negeri jiran itu. Apa tidak pernah terusik untuk berpikir, bagaimana nasib para perajin dan pekerja seni di negeri ini jika mereka harus menyerahkan sejumlah royalty ke negeri jiran karena secara hukum, kita sudah tak memiliki hak atas produk-produk budaya yang telah dipatenkan Malaysia itu.

Ulah Malaysia juga perlu dijadikan sebagai “warning” buat bangsa kita agar tak terlalu silau dengan budaya global yang selama ini (nyaris) telah menggerus jati diri bangsa. Kita yang selama ini abai terhadap budaya kita sendiri, baru teriak kencang-kencang setelah diklaim negeri lain. Dalam kondisi demikian, kita perlu membangun kembali kesadaran kultural secara kolektif setelah kita terninabobokan dan terhipnotis oleh kultur global yang secara langsung maupun tidak langsung telah membuat kita terlena dan abai terhadap budaya negeri sendiri.

Dari search engine, ada beberapa produk budaya Indonesia yang diduga telah dicaplok oleh Malasyia. Berikut ini daftarnya.
1.Batik
2.Tari Pendet
3.Wayang Kulit
4.Angklung
5.Reog Ponorogo
6.Kuda Lumping
7.Lagu Rasa Sayange
8.Bunga Rafflesia Arnoldi
9.Keris
10.Rendang Padang

batikpendetwayang kulitangklungreog-ponorogokuda_lumpingvisitmalingsiarafflesiakerisrendang-padang

Sementara itu, menurut versi budaya-indonesia.org, sudah lebih banyak lagi daftar artefak budaya Indonesia yang diduga dicuri, dipatenkan, diklaim, dan atau dieksploitasi secara komersial oleh korporasi asing, oknum warga negara asing, ataupun negara lain. Berikut ini daftarnya:

  1. Batik dari Jawa oleh Adidas
  2. Naskah Kuno dari Riau oleh Pemerintah Malaysia
  3. Naskah Kuno dari Sumatera Barat oleh Pemerintah Malaysia
  4. Naskah Kuno dari Sulawesi Selatan oleh Pemerintah Malaysia
  5. Naskah Kuno dari Sulawesi Tenggara oleh Pemerintah Malaysia
  6. Rendang dari Sumatera Barat oleh Oknum WN Malaysia
  7. Sambal Bajak dari Jawa Tengah oleh Oknum WN Belanda
  8. Sambal Petai dari Riau oleh Oknum WN Belanda
  9. Sambal Nanas dari Riau oleh Oknum WN Belanda
  10. Tempe dari Jawa oleh Beberapa Perusahaan Asing
  11. Lagu Rasa Sayang Sayange dari Maluku oleh Pemerintah Malaysia
  12. Tari Reog Ponorogo dari Jawa Timur oleh Pemerintah Malaysia
  13. Lagu Soleram dari Riau oleh Pemerintah Malaysia
  14. Lagu Injit-injit Semut dari Jambi oleh Pemerintah Malaysia
  15. Alat Musik Gamelan dari Jawa oleh Pemerintah Malaysia
  16. Tari Kuda Lumping dari Jawa Timur oleh Pemerintah Malaysia
  17. Tari Piring dari Sumatera Barat oleh Pemerintah Malaysia
  18. Lagu Kakak Tua dari Maluku oleh Pemerintah Malaysia
  19. Lagu Anak Kambing Saya dari Nusa Tenggara oleh Pemerintah Malaysia
  20. Kursi Taman Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Perancis
  21. Pigura Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Inggris
  22. Motif Batik Parang dari Yogyakarta oleh Pemerintah Malaysia
  23. Desain Kerajinan Perak Desak Suwarti dari Bali oleh Oknum WN Amerika
  24. Produk Berbahan Rempah-rempah dan Tanaman Obat Asli Indonesia oleh Shiseido Co Ltd
  25. Badik Tumbuk Lada oleh Pemerintah Malaysia
  26. Kopi Gayo dari Aceh oleh perusahaan multinasional (MNC) Belanda
  27. Kopi Toraja dari Sulawesi Selatan oleh perusahaan Jepang
  28. Musik Indang Sungai Garinggiang dari Sumatera Barat oleh Malaysia
  29. Kain Ulos oleh Malaysia
  30. Alat Musik Angklung oleh Pemerintah Malaysia
  31. Lagu Jali-Jali oleh Pemerintah Malaysia
  32. Tari Pendet dari Bali oleh Pemerintah Malaysia

Sudah saatnya kita kembali meneguhkan sikap untuk peduli dan membangun kesadaran kultural secara kolektif untuk merebut kembali produk budaya yang telah dicaplok orang itu. Sebagai bangsa yang besar, kita jangan gampang menyerah dan bersikap permisif. Ayo, rebut kembali produk-produk budaya bangsa kita yang hilang itu. Kalau tidak sekarang, kapan lagi? ***

Read Full Post »

Marhaban ya RamadhanBulan yang sarat dengan berkah dan maghfirah yang sudah kita tunggu selama satu tahun itu akhirnya tiba juga. Ya, ya, ya, bulan ini tidak saja menjanjikan dan “memanjakan” rohaniah kita karena setiap amal yang baik akan mendapatkan pahala berlipat-lipat, tetapi juga melatih kita untuk bersikap sabar dan mampu mengapresiasi pengejawantahan sikap qanaah, sabar, dan menghargai sebuah proses.

Nah, selamat menyongsong kehadiran bulan suci Ramadhan, semoga kita semua dapat menunaikan kewajiban mulia itu sebulan peniuh. Mohon maaf lahir dan batin.

Read Full Post »

baronganKontes SEO bertema Mengembalikan Jati Diri Bangsa yang digelar BeritaJitu.com sungguh menarik diikuti. Bukan lantaran SEO-nya, melainkan temanya yang memang menantang untuk dikaji dan didiskusikan. Secara jujur, kita mesti mengakui, bahwa jati diri bangsa kita belakangan ini memang menampakkan potret buram. Nilai-nilai kesejatian diri bangsa yang dulu terekspresikan melalui sikap ramah, santun, setia kawan, gotong royong, dan sikap-sikap fatsun kehidupan yang lain, makin memudar di tengah meruyaknya sikap pragmatis, materialistis, konsumtif, dan hedonis. Sikap ke-kita-an telah berubah menjadi sikap ke-kami-an, bahkan dinilai telah terdegradasi ke dalam sikap ke-“aku”-an. Dalam konteks demikian, tidak berlebihan apabila perlu ada upaya serius untuk mengembalikan jati diri bangsa yang dinilai telah hilang itu.

Pada saat awal-awal kebangkitan nasional, persoalan ke-aku-an, etnisitas dan kesukuan melebur menjadi sebuah kekuatan dahsyat hingga mampu memercikkan semangat pembebasan dari nilai-nilai kolonialisme yang dengan amat sadar dilakukan oleh kaum penjajah. Tonggak kebangkitan nasionalisme itu juga telah merangsang tumbuhnya keinsyafan kolektif sebagai bangsa yang bermartabat, terhormat, dan berdaulat. “Rawe-rawe rantas, malang-malang putung”; begitulah adagium yang mampu memompakan semangat juang untuk menyatu dalam sebuah wadah kebersamaan menuju “Indonesia Baru”; Indonesia yang merdeka; bebas menentukan nasib sendiri; tanpa intervensi.

Nilai-nilai Kesejatian Diri yang Tererosi
Seiring dengan perubahan yang terus terjadi, sejak masa prakemerdekaan hingga pascakemerdekaan, nilai-nilai kesejatian diri itu dinilai juga mengalami pasang-surut. Dengan nada sedih, kita harus jujur mengakui bahwa nilai-nilai jati diri di negeri ini terus mengalami erosi. Tanpa bermaksud menjadikan nilai-nilai modernisme dan globalisme sebagai kambing hitam, disadari atau tidak, kita juga telah terperangkap, bahkan terjebak ke dalam nilai-nilai pragmatisme. Pergeseran nilai terus terjadi di segenap lapis dan lini kehidupan masyarakat. Semangat dan roh para pendiri negeri ini (nyaris) hanya memfosil dalam buku-buku sejarah dan museum. Selebihnya, kita telah “menuhankan” hal-hal yang pragmatis; politis dan ekonomis. Keinsyafan kolektif sebagai bangsa yang terhormat dan bermartabat, disadari atau tidak, telah menjelma menjadi kelatahan sikap yang memuja kebendaan dan kenikmatan semu. Bendera materialisme dan hedonisme terus berkibar di ranah-ranah publik. Secara kolektif, kita telah masuk perangkap pemujaan dan perhatian yang berlebihan terhadap interes-interes materiil dan praktis.

Yang menyedihkan, upaya pewarisan semangat jati diri selama ini dinilai telah tereduksi oleh kekuasaan. Pemberangusan buku-buku sejarah, misalnya, adalah sebuah contoh konkret betapa fakta-fakta sejarah menjadi demikian rentan terhadap penafsiran penguasa. Buku-buku sejarah yang dinilai tidak berpihak kepada penguasa dibrangus tanpa ampun. Bisa ditebak, yang terjadi kemudian adalah pembonsaian generasi dan anak-anak bangsa. Mereka sengaja dikerdilkan dan dihambat pertumbuhannya agar tak bisa bebas mengerti persoalan masa lalu yang pernah dialami oleh masyarakat dan bangsanya. Dalam kondisi demikian, tidak berlebihan apabila banyak anak-anak negeri ini yang tidak tahu sejarah yang benar mengenai jati diri bangsa dan negerinya sendiri.

Mengembalikan Jati Diri Bangsa
Kini, kita sudah merasakan atmosfer reformasi lebih dari satu dekade. Pertanyaan yang muncul adalah sudah adakah perubahan yang cukup bermakna dalam upaya mengembalikan jati diri bangsa yang dinilai telah tererosi itu? Lantas, bagaimana dengan bidang kebudayaan? Dengan nada sedih harus dikatakan bahwa budaya merupakan ranah yang tak tersentuh oleh reformasi, bahkan semenjak negeri ini berada di atas tungku kekuasaan Orde Baru. Kebudayaan benar-benar menjadi sebuah Indonesia yang tertinggal.

Lihatlah, betapa –meminjam istilah Slamet Sutrisno (1997) — semakin tidak intensnya seseorang dalam memburu jati diri yang lebih bermartabat. Perburuan gengsi yang berkembang dalam kelatahan membuat orang mengejar keberhasilan secara instan, entah melakukan korupsi atau usaha magis melalui cara mistis dalam memperoleh kekayaan. Pada hakikatnya mereka gemar menempuh terobosan dan “jalan kelinci” dengan sukses gaya “Abu Nawas”. Kursi empuk kepejabatan, titel, dan kedudukan keilmuan pun tak jarang disergap melalui kelancungan dalam ilmu permalingan”.

Agaknya, bangsa kita memang telah “ditakdirkan” untuk menjadi bangsa pelupa. Kita (nyaris) tak pernah belajar pada pengalaman-pengalaman masa silam. Yang sering kita ingat, bukan esensinya, melainkan asesorisnya. Kita lupa bahwa pada awal-awal pergerakan nasional, para pendiri negeri ini dengan amat sadar menyentuh persoalan kebudayaan sebagai basis perubahan dalam upaya menggapai jati diri. Kebudayaanlah yang telah menyatukan berbagai kelompok etnis dan suku ke dalam sebuah wadah, sehingga mampu menorehkan tinta sejarah melalui Gerakan Budi Utomo (1908) yang dikokohkan kembali melalui Sumpah Pemuda (1928). Berkat sentuhan kebudayaan, mimpi “Indonesia Baru” yang merdeka dan berdaulat akhirnya menjadi sebuah kenyataan.

Upaya mengembalikan jati diri bangsa itu agaknya hanya akan menjadi sebuah mimpi apabila ranah kebudayaan tak disentuh. Satu dekade lebih perjalanan reformasi seharusnya sudah mampu memberikan kemaslahatan publik dalam upaya mengembalikan jati diri yang dinilai telah hilang itu. Telinga kita sudah demikian jenuh mendengar bahasa politik dan ekonomi yang tak henti-hentinya mengedepankan “siapa yang menang” dan “apa untungnya”. Sudah saatnya kita memperluas makna perubahan dengan menyentuh akar-akar kebudayaan dengan mengedepankan pertanyaan “apa yang benar”.

Itulah yang selama ini kita lupakan sehingga lebih dari satu dekade reformasi belum juga menumbuhkan optimisme hidup dalam mengembalikan jati diri bangsa yang hilang. Kita merindukan “keinsyafan kolektif” untuk menyentuh kebudayaan sebagai salah satu dimensi kehidupan dalam menggapai kesejatian diri bangsa yang terhormat dan bermartabat. ***

Tulisan ini sekaligus juga sebagai bentuk dukungan terhadap tulisan “Mengembalikan Jati Diri Bangsa: Haruskah Menjadi Sebuah Utopia?” yang diikutsertakan dalam kontes SEO yang digelar oleh beritaJitu.com untuk yang pertama kalinya.

Read Full Post »

Older Posts »

Ikuti

Get every new post delivered to your Inbox.