Feeds:
Pos
Komentar

Archive for the ‘Budaya’ Category

Tampil dengan kostum yang kontras sebatas dada dihiasi make up yang medhok-merok dan bau parfum yang menyengat hidung, kemudian berlenggang-lenggok di atas gelaran tikar merupakan ciri khas sripanggung pertunjukan tayub. Masyarakat Grobogan menyebutnya sebagai ledhek. Mereka tampil jika diundang oleh warga desa yang kebetulan punya hajat, entah itu khitanan maupun resepsi perkawinan.

Keberadaan ledhek di tengah-tengah masyarakat Grobogan yang mayoritas hidup dalam lingkungan agraris nyaris menyaingi seni hiburan lain semacam wayang kulit, wayang orang, atau ketoprak. Seni tayub masih diuri-uri meski hiburan berbau elektronik sejenis video juga muncul scara sporadis jika kebetulan ada warga desa yang punya hajat. Apakah ini merupakan kompensasi warga desa yang haus hiburan di sela-sela rutinitas pekerjaan bertaninya yang membelenggu ataukah memang telah kadung menjadi tradisi yang mengilus-sumsum sehingga kalau ditinggalkan ada gendam yang musti ditanggung?

Seremoni Nazar
Konon, dulu seni tayub hanyalah sebuah tontonan perlengkapan seremoni nazar bagi warga desa yang kebetulan punya uni alaias nazar. Masyarakat Grobogan meyakini adanya mitos, jika pernah punya nazar, tetapi tidak segera dilaksanakan setelah niatnya tercapai, maka yang bersangkutan akan dirundung malapetaka. Misalnya, ada anggota keluarga yang sakit parah, bahkan sampai meninggal dunia atau dapat pula berubah musibah fatal yang lain. Sebagai medium pengabulan nazar, diundanglah ledhek untuk menolak musibah yang bakal datang. Selain itu, juga sebagai pengucapan rasa syukur kepada Hyang Widhi atas niat dan maksudnya yang telah terkabul. Lama pertunjukan cukup singkat sekitar 1-2 jam. Konon, mantra-mantra yang diucapkan sang ledhek itulah yang sanggup meredam segala musibah.

Dengan iringan gamelan yang mengalun, sang ledhek mulai mengucapkan matra dalam bentuk tembang. Ada suasana sakral di sana. Di tengah asap dupa yang membubung dengan segenap uba rapenya semacam ayam panggang, keris, onggokan pisang, ketupat, dan beras putih, sang ledhek tak henti-hentinya mengucapkan mantra sambil menyebar beras putih ke segala penjuru sebagai tulak balak: “…ana sengkala saka kulon tinulak bali mangulon. Sing nulak balak Raja Iman Slamet …” (ada musibah dari barat ditolak kembali ke barat. Yang menolak Raja Iman Selamat) ….” Byur! Beras putih disebar ke arah barat. Demikian seterusnya higga tujuh kali sesuai dengan arah yang disebutkan. Setelah sang ledhek selesai mengucapkan mantra dalam bentuk tembang, tamatlah pertunjukan sebagai pertanda bahwa nazar telah dilaksanakan. Mereka yakin, musibah tak mungkin muncul sekaligus sang empunya nazar terhindari dari segala petaka.

Namun, seirama perkembangan seni hiburan di daerah pelosok pedesaan, seni tayub kini berubah fungsi, suasana, dan temponya. Dari fungsinya sebagai perlengkapan seremonial nazar beralih fungsi sebagai hiburan semata. Suasana sakral pun sirna berganti suasana hingar-bingar di tengah musik gamelan yang membubung ditingkah ketipak kendang yang keras membentak. Tempo pertunjukannya pun berlangsung semalam suntuk alias byar klekar seperti hiburan lain pada umumnya.
 
Seronok
Tayub, konon merupakan jarwa-dhosok (akronim) “Yen ditata dadi guyub” (kalau ditata jadi guyup/rukun). Ada makna harfiahnya. Pertunjukan tayub yang melibatkan ± lima pria sebagai penayub dengan dua atau tiga ledhek sebagai sripanggungnya, kalau ditata dan diatur nyaris mampu menampilkan suasana paguyuban yang kuyup akan nilai persaudaraan, kerukunan, dan kekeluargaan. Namun, toh akhirnya makna harfiah yang kuyup nilai itu jadi sirna lantaran dibikin sendiri oleh ulah penayubnya yang kadang seronok, hampir-hampir menjurus ke tingkah pornografi.

Lazimnya, pertunjukan dimulai pukul 21.00 didahului dengan pembukaan instrumen gamelan para niyaga. Setelah semuanya siap, sang ledhek mulai memburu mangsa yang duduk di ruang tamu. Biasanya, mangsa (baca: penayub) yang ketiban smapur atau diberi selendang oleh ledheknya memberi imbalan Rp500. pertunjukan dibagi dalam 2 tahap, yakni mulai pukul 21.00 hingga pukul 24.00 giliran pinisepuh dan warga yang tergolong usia tua dan mulai pukul 0.00 dini hari hingga selesai giliran anak-anak muda. Jika diamati, pada tahap kedualah yang paling gempar.

Boleh dibilang bahwa pada tahap ini pertunjukan mencapai puncak ekstasenya. Nyaris tak ada batas antara penonton dan para penayub. Mereka sama-sama lebur dalam suasana yang hingar-bingar. Semakin larut malam, penonton kian meruah dengan tepuk sorak yang membahana. Pada tahap kedua ini, cara menayub terbagi dalam dua teknik, yakni menari dan ngepos.

Bagi para pemuda yang terampil menari, mereka memilih cara yang pertama dengan mengundang teman-temannya –istilahnya sambatan—untuk bersama-sama menari di tengah pertunjukan. Mereka bebas memilih gending-gending Jawa yang keras dan hingar-bingar dengan suara hentakan kendang yang cukp dominan, seperti gumbul thek, kijing miring, godril, celeng mogok, goyang semarang, dan semacamnya. Sambil menari, mereka mulai bertingkah. Tubuhnya mulai menghimpit, memeluk, bahkan mencium. Penonton dari semua tingkatan usia pun bersorak tempik. Mereka bergumul tanpa malu-malu, meski dilihat oleh sanak saudara dan kerabatnya. Barangkali ini sebagai kompensasi bagi para pemuda desa yang haus hiburan di sela-sela rutinitas kesehariannya yang maton.tanpa variasi.

Sedangkan, bagi para pemuda yang tak becus menari, cukup dengan ngepos, yakni duduk di kursi panjang sambil memangku sang ledhek. Mereka mirip benar dnegan insan manusia yang tengah dimabuk asmara. Dengan diiringi gending-gending Jawa yang rata-rata halus-romantis, semacam sida asih, lara branta, rujak jeruk, yen ing tawang ana lintang, dan sebagainya, mereka mulai bertingkah seronok seolah-olah benar-benar ingin melampiaskan rupa birahinya yang menggelora.

Bisa dipastikan, bila ada orang punya hajat, jauh-jauh hari mereka mengumpulkan uang. Memang beginikah sikap para pemuda desa dalam upaya menyiasati kepekaan rohani dan kodrati terhadap hiburan di abad gelombang informasi ini? Ya, barangkali memang ini merupakan siasat guna mengentaskan diri dari himpitan zaman yang menelikungnya.
 
Tanpa Beban Dosa
Ledhek, konon merupakan jarwa-dhosok dari “Elek ben angger gelem medhek-medhek” (biar jelek asal mau mendekat). Seperti kebanyak ledhek di daerah kabupaten Grobogan, modal kecantikan tak begitu penting, meski juga berpengaruh dalam hal pemasaran. Modalnya cukup dengan dandanan yang seronok dengan vokal yang lancar selama semalam suntuk ditambah dengan keberanian mendekati kaum lelaki. Dan, agaknya mereka tampil seperti layaknya menawarkan kodrat profesi, tanpa merasa dihimpit beban dosa.

Pekerjaan, apa pun bentuk dan macamnya, kalau sudah cocok dengan kehendak nurani, memang kadang-kadang tak pandang soal etika. Kalau memang pekerjaan semacam yang dilakukan oleh Tukiyem itu sudah menjadi tuntutan nuraninya, dapatlah ia dijadikan sebagai tameng pendobrak kehidupan yang kian sulit seperti sekarang ini, meski ada bias-bias tuntutan moral di sana. Para ledhek dalam kehidupan sehari-harinya pun hidup wajar bersama warga yang lain, tanpa ada beban moral yang mesti ditanggung.

Ledhek barangkali bisa disamakan dengan keberadaan cokek di Sragen, atau tandak di Surabaya yang diterjuni secara wajar-wajar saja tanpa adanya perangkat upacara perangkat penobatan. Akan tetapi, berbeda dnegan ronggeng di daerah Banyumas yang mengenal adanya tradisi bukak klambu, yang harus rela menyerahkan kehormatannya sebelum dinobatkan sebagai ronggeng. Ledhek di Grobogan, seperti layaknya profesi yang lain, diterjuni secara wajar-wajar saja. Asal ada niat dan sanggup, meluncurlah mereka ke tengah-tengah masyarakat sebagai ledhek.

Namun begitu, mengintip pertunjukan tayub Grobogan yang rata-rata menampilkan adegan seronok, perlu diadakan garis kebijaksanaan yang tegas dari pihak yang berwenang, mengingat pertunjukan ini ditonton oleh seluruh lapisan masyarakat tanpa mengenal tingkatan usia. Hal ini bisa menimbulkan dampak negatif yang lebih runyam jika tidak segera mendapatkan uluran kebijakan. Apa kata anak-anak jika melihat sanak saudaranya bergumul bersama ledhek tanpa ada jarak yang memisahkan. Para orang tua seolah meneladani anak-anaknya dengan petingkah yang seronok.

Beranjak dari sisi ini, haruskah pertunjukan tayub yang nyaris hanya memburu segi tontonan dan menihilkan unsur tuntunan, mesti diuri-uri? Ya, perlu ada penegasan yang manusiawi tanpa menyinggung perasaan dan harkat warga desa yang rata-rata lugu dan polos. Paling tidak, jarak antara ledhek dan penayub perlu dibatasi. ***

Read Full Post »

Akhirnya, dunia mengakui batik sebagai produk budaya Indonesia. Unesco mengukuhkan batik ke dalam daftar representatif budaya tak benda warisan manusia atau Representative List of Intangible Cultural Heritage. Pengukuhan ini jelas menjadi kebanggaan tersendiri buat bangsa kita setelah melalui berbagai macam cara, negeri jiran, Malaysia, berupaya mengklaim sebagai produk budaya mereka.

batikbatikbatikbatikMeski demikian, kita tidak cukup hanya berpuas diri pasca-pengukuhan di Abu Dhabi, Uni Emirat Arab, 2 Oktober 2009 itu. Batik tak cukup hanya dilestarikan, tetapi juga perlu terus ditumbuhkembangkan sesuai dengan tuntutan dan dinamika zaman. Dengan kata lain, batik tak hanya berhenti sebatas produk warisan budaya belaka, tetapi juga perlu terus mampu beradaptasi sesuai dengan gerak dan dinamika masyarakat pemakainya.

Dalam perspektif budaya, batik mengandung nilai filosofis yang cukup tinggi, baik dari sisi motif, cara pembuatan, hingga lamanya proses membuat selembar kain batik. Batik menyimbolkan doa dan harapan bagi pemakainya. Bukan hanya itu. Batik juga menunjukkan hasil jerih payah dan kesabaran pembuatnya.

Kurator Museum Batik Jogjakarta, Prayoga, menyatakan, tidak semua penggemar batik paham akan konsep dan filosofi di balik pembuatan kain batik. Pembuat kain batik, lanjutnya, harus dalam kondisi tenang saat membatik. Tak heran, beberapa pembatik harus berpuasa sebelum membatik. “Membatik itu butuh ketenangan. Kita tidak boleh membatik jika sedang gelisah karena akan berpengaruh langsung kepada kain yang kita batik,” tuturnya.

Membatik juga membutuhkan kesabaran dan disiplin ekstra. Dalam satu lembar kain batik, butuh beberapa kali tahap pewarnaan sebelum batik siap dipakai. “Bisa 17 kali kalau memang rumit. Dan, itu memakan waktu. Karena itu, kadang satu batik bisa dibuat hingga satu tahun,” ujarnya.

Kedisiplinan, lanjutnya, ditunjukkan dengan jumlah takaran malam yang pas. “Saat akan membatik, kita harus menakar penggunaan malam dengan pas. Tidak boleh lebih dan tidak boleh kurang. Jika pekerjaan kita tidak selesai, entah itu malamnya kurang atau berlebih, berarti ada yang salah dengan kita,” kata pria berusia 55 tahun ini.

Dalam budaya masyarakat Jawa, kain batik tidak hanya digunakan untuk sandang atau pakaian. Batik menunjukkan prestise dan berfungsi mengungkapkan sesuatu. “Zaman dahulu, kalau anak laki-laki mau melamar, dia harus membawa kain batik dengan motif tertentu kepada orang tua si gadis. Dia tinggal menyerahkan dan orang tua langsung tahu apa maksudnya,” terangnya.

Dalam perspektif budaya Jawa, setiap motif batik memiliki kandungan makna yang berbeda-beda.
1.Batik Parang atau lereng menurut pakemnya hanya boleh digunakan oleh sentono dalem (anak dari ratu). Lereng berasal dari kata mereng (lereng bukit). Sejarah motif ini diawali ketika terjadi pelarian keluarga kerajaan dari Kraton Kartasura. Para keluarga raja terpaksa bersembunyi di daerah pegunungan agar terhindar dari bahaya.

2. Jenis batik truntum dipakai saat seseorang menggelar pesta hajatan. Motif truntum sendiri ditemukan oleh Istri dari Pakubuwana V. Saat itu beliau sedang menjalani hukuman karena melanggar peraturan kerajaan. Pada suatu malam beliau merenung dan memandangi langit berbintang yang ada di angkasa kemudian beliau menuangkan apa yang dia lihat dengan chanthing sehingga menjadi motif batik truntum.

3. Batik sidamukti dipakai oleh pasangan pengantin. Sidamukti sendiri melambangakan sebuah harapan, jadi seketika sepasang pengantin menggunakan kain sidamukti, maka muncul keinginan untuk mencapai kehidupan baru yang berhasil atau dalam bahasa jawa disebut mukti.

4. Batik sido drajad dipakai oleh besan ketika upacara pernikahan. Cara pemakaian batik juga memiliki nilai pendidikan tersendiri, berikut adalah beberapa uraian dari cara pemakaian kain batik. Bagi anak-anak batik dipaki dengan cara sabuk wolo. Pemakaian jenis ini memungkinkan anak-anak untuk bergerak bebas. Secara filosofis pemakaian sabuk wolo diartikan bebas moral, sesuai dengan jiwa anak-anak yang masih bebas dan belum dewasa dan belum memiliki tanggungjawab moral di dalam masyarakat. Ketika beranjak remaja maka seseorang tidak lagi mengenakan batik dengan cara sabuk wolo melainkan dengan jarit. Panjang jarit yang dipakai memiliki arti tersendiri. Seamakin pajang jarit maka semakin tinggi derajad seseorang dalam masyarakat semakin pendek jarit maka semakin rendah pula strata sosial orang tersebut dalam masyarakat.

Bagi dewasa pemakaian batik memiliki pakem tersendiri antara laki-laki dan perempuan. Pada laki-laki wiru diletakkan di sebelah kiri. Sedangkan pada wanita wiru diletakkan di sebelah kanan, yang berarti nengeni. Artinya seorang putri tidak boleh melanggar khendak suami.

Semoga pengukuhan batik oleh Unesco terus mengilhami para perajin batik untuk terus melakukan inovasi dan mengembangkan kreativitasnya dalam menciptakan motif-motif batik yang sesuai dengan tuntutan dan dinamika zaman, hingga akhirnya tak ada negeri lain yang bisa mengklain batik sebagai produk budaya mereka. ***

Read Full Post »

Jumat, 25 September 2009, saya mendapatkan kehormatan menerima kedatangan Mas Khika. Ini untuk yang kedua kalinya bloger yang tengah getol mengelola taman baca itu menyambangi gubug saya. Kedatangan yang pertama terjadi sekitar bulan Maret 2009 yang lalu.

Ketika saya mudik beberapa hari sebelumnya, lelaki muda yang masih suka mengembara di sela-sela rutinitas kesehariannya di dunia IT itu memang sempat kontak saya melalui HP. Dia mengabarkan kalau dia sudah berada di Batang, sebuah kota yang bertetangga dekat dengan Kendal. Seperti biasanya, saya mengharapkan Mas Khika untuk bermain ke Kendal jika ada waktu. Alhamdulillah, bloger yang selama ini bermukim di Bogor itu akhirnya benar-benar datang ke gubug saya.

KhikaKhikaKarena masih harus melanjutkan perjalanan ke Batang, Mas Khika tak bisa berlama-lama ngobrol dengan saya, apalagi keesokan harinya, dia akan menyempatkan diri untuk datang ke markas Jogloabang yang tengah punya hajat menggelar acara halal-bihalal, yang kemudian hendak diteruskan untuk bertemu dengan Mas Totok Sugiarto di puncak Gunung Kelir. Sebelum kabar ini saya sampaikan kepada Mas Khika, saya memang sempat di-sms Mas Ciwir perihal hajat itu. Saya diundang untuk bisa datang ke markas Demang Suryaden itu. Sang Bayang pun juga sempat kontak saya lewat telepon untuk memastikan bisa tidaknya saya datang dalam momen silaturahmi lebaran di Sleman itu.

JogloabangNamun, dengan berat hati, saya tidak bisa ikut hadir dalam acara yang sesungguhnya sudah lama saya nantikan itu. Bagi saya, Jogloabang saya nilai punya daya pesona dan aura tersendiri. Para penggiat Jogloabang, selain menjadi pioner penggunaan software open source, juga amat peduli terhadap perkembangan lingkungan pedesaan yang selama ini memang telah menjadi “mazab” dalam web komunitasnya. Mohon maaf Mas Suryaden, Mas Ciwir, dan sahabat-sahabat bloger Jogloabang atas ketidakhadiran saya dalam momen silaturahmi yang amat menjanjikan nilai keakraban dan kekeluargaan itu. Mohon dimaklumi, antara 26-29 September ini, saya tidak bisa meninggalkan rumah. Kebetulan saja, tetangga sebelah yang sangat dekat dengan saya dan keluarga, pada 28 September nanti sedang punya hajat mantu. Saya dan keluarga didaulat untuk ikut membantu menyiapkan segala sesuatunya. Kemudian, keesokan harinya, gubug saya jadi tempat pelaksanaan halal-bihalal keluarga besar SMP 2 Pegandon, tempat saya mengajar selama ini.

Obrolan semacam itulah yang saya sampaikan kepada Mas Khika yang tampak begitu bersemangat untuk datang ke Jogloabang.

“Apa tidak kontak dulu ke Mas Suryaden, Mas Khika?” tanya saya.

“Itu yang selalu saya hindari, Pak. Biar ada surprise, hehe …. Apalagi, kalau saya ngobrol dengan Suryaden dan Senoaji…” jawab Mas Khika.

Loh, memangnya kenapa?”

“Ndak pernah bisa akur, Pak, hehe …. Selalu saja ndak ada yang mau ngalah, wakakaka …” selorohnya.

“Walah!”

Meski pertemuan saya dengan Mas Khika cukup singkat, tapi selalu menjanjikan geliat persaudaraan dan keakraban. Bisa jadi, inilah salah satu manfaat ngeblog. Punya banyak sahabat dan saudara. Ke mana-mana hanya tinggal meninggalkan pesan lewat chat, FB, email, atau sms.

Saya pun tak sanggup menahan kepergian Mas Khika yang masih harus melanjutkan perjalanannya ke Batang, ke kampung kelahirannya itu. Ok, Mas Khika, selamat berkelana, semoga lancar dan selamat! ***

Read Full Post »

ubuntu1Ternyata ada untungnya juga jadi orang nekad. Nekad untuk bisa secepatnya terlepas dari cengkeraman perangkat lunak berharga setinggi langit dari sang jendela yang bertahun-tahun lamanya telah melahirkan jamaah pembajak. Ya, ya, ya, harga produk-produk microsoft yang terbilang mahal, disadari atau tidak, justru telah membuka peluang pembajakan perangkat lunak sebagai sebuah budaya. Orang merasa tidak risih ketika perangkat lunak yang digunakan sejatinya merupakan produk tak halal dan nyata-nyata telah melanggar hak cipta.

Dalam kondisi demikian, sungguh sebuah terobosan yang menarik apabila penggunaan software open source terus digalakkan, utamanya kalangan kelas menengah ke bawah yang selama ini telah ikut terperangkap dalam sebuah imperium penjajahan yang “dengan sengaja” dilakukan oleh kaum pemilik modal.

Setelah nekad dan terus “terprovokasi” oleh beberapa teman yang sudah terlebih dahulu melenggang memaknai kebebasan dengan menggunakan perangkat lunak open-source, akhirnya saya berhasil juga melakukan migrasi. Pilihan jatuh pada software Ubuntu 9.04 yang menggunakan codename “Jaunty Jackalope”. Sebagai pengguna baru, pemilihan perangkat lunak itu bukan lantaran saya bisa membandingkan kelebihan dan kekurangan sebuah software, melainkan semata-mata nekad saja. Penginstalan Ubuntu 7.10 Gutsy Gibbon pernah memberikan pengalaman buruk buat pengguna perangkat IT yang gaptek seperti saya. Saya terpaksa beralih ke jendela karena fitur dan fasilitas yang ditawarkan belum sepenuhnya mendukung kinerja PC saya, mulai driver sound, video, printer, dan perangkat lunak yang lain.

Ubuntu 9.04 Jaunty Jackalope benar-benar mengubah pandangan saya tentang software open-source. Fitur dan perangkat yang ditawarkan sungguh membuat saya jatuh cinta. Ia tidak saja membebaskan saya dari mitos pembajakan, tetapi juga membuat saya bebas menikmati kemudahan-kemudahan dalam menginstal perangkat pendukung sistem operasi di netbook yang saya gunakan. Melalui terminal, synaptic, update manager, atau add/remove, saya bisa dengan mudah menginstalasi perangkat pendukung kinerja komputer. Kemudahan ini juga saya peroleh berkat “kemauan baik” sahabat-sahabat pengguna open source yang mau membangun semangat berbagi dan share dalam mengoptimalkan kinerja sofware open source dalam sistem operasi komputer. Saya bisa dengan mudah menemukan tulisan dan tutorial open source itu lewat search-engine.

Terima kasih para sahabat pengguna linux yang telah membuka mata fisik dan batin saya untuk tidak terus-terusan terperangkap dalam mitos pembajakan perangkat lunak dari tahun ke tahun. ***

Read Full Post »

Entah, produk budaya Indonesia apa lagi yang hendak dicaplok negeri Jiran. Yang pasti, hingga saat ini, sudah ada puluhan produk budaya kita yang nyata-nyata telah diklaim dan dipatenkan oleh sebuah negara kecil yang konon tak pernah merasakan etos perjuangan dan buta kebudayaan itu. Bagaimana tidak? Malaysia tak se-heroik Indonesia dalam berjuang merebut dan mempertahankan eksistensi negara-bangsa. Untuk mempertahankan dan merebut eksistensi negara yang merdeka dan berdaulat penuh, Indonesia mesti berdarah-darah dan mengorbankan segalanya. Lain halnya dengan Malaysia. Mereka bisa hidup makmur karena proteksi dan belas kasihan negara lain yang dulu menjajahnya. Semua kemanjaan mereka dapatkan secara instan. Tak heran apabila Malaysia ktak pernah bisa menghargai karya cipta dan kreativitas bangsa serumpun. Mereka juga tak pernah mengenal dan mengasah kepekaan kultural. Karena tak pernah mengenal dinamika berkesenian dan berkebudayaan, merka hanya bisa menjiplak, main klaim, mencuri, dan main caplok.

Ironisnya, pemerintah kita seperti tutup mata dan tutup telinga terhadap ulah negeri jiran itu. Apa tidak pernah terusik untuk berpikir, bagaimana nasib para perajin dan pekerja seni di negeri ini jika mereka harus menyerahkan sejumlah royalty ke negeri jiran karena secara hukum, kita sudah tak memiliki hak atas produk-produk budaya yang telah dipatenkan Malaysia itu.

Ulah Malaysia juga perlu dijadikan sebagai “warning” buat bangsa kita agar tak terlalu silau dengan budaya global yang selama ini (nyaris) telah menggerus jati diri bangsa. Kita yang selama ini abai terhadap budaya kita sendiri, baru teriak kencang-kencang setelah diklaim negeri lain. Dalam kondisi demikian, kita perlu membangun kembali kesadaran kultural secara kolektif setelah kita terninabobokan dan terhipnotis oleh kultur global yang secara langsung maupun tidak langsung telah membuat kita terlena dan abai terhadap budaya negeri sendiri.

Dari search engine, ada beberapa produk budaya Indonesia yang diduga telah dicaplok oleh Malasyia. Berikut ini daftarnya.
1.Batik
2.Tari Pendet
3.Wayang Kulit
4.Angklung
5.Reog Ponorogo
6.Kuda Lumping
7.Lagu Rasa Sayange
8.Bunga Rafflesia Arnoldi
9.Keris
10.Rendang Padang

batikpendetwayang kulitangklungreog-ponorogokuda_lumpingvisitmalingsiarafflesiakerisrendang-padang

Sementara itu, menurut versi budaya-indonesia.org, sudah lebih banyak lagi daftar artefak budaya Indonesia yang diduga dicuri, dipatenkan, diklaim, dan atau dieksploitasi secara komersial oleh korporasi asing, oknum warga negara asing, ataupun negara lain. Berikut ini daftarnya:

  1. Batik dari Jawa oleh Adidas
  2. Naskah Kuno dari Riau oleh Pemerintah Malaysia
  3. Naskah Kuno dari Sumatera Barat oleh Pemerintah Malaysia
  4. Naskah Kuno dari Sulawesi Selatan oleh Pemerintah Malaysia
  5. Naskah Kuno dari Sulawesi Tenggara oleh Pemerintah Malaysia
  6. Rendang dari Sumatera Barat oleh Oknum WN Malaysia
  7. Sambal Bajak dari Jawa Tengah oleh Oknum WN Belanda
  8. Sambal Petai dari Riau oleh Oknum WN Belanda
  9. Sambal Nanas dari Riau oleh Oknum WN Belanda
  10. Tempe dari Jawa oleh Beberapa Perusahaan Asing
  11. Lagu Rasa Sayang Sayange dari Maluku oleh Pemerintah Malaysia
  12. Tari Reog Ponorogo dari Jawa Timur oleh Pemerintah Malaysia
  13. Lagu Soleram dari Riau oleh Pemerintah Malaysia
  14. Lagu Injit-injit Semut dari Jambi oleh Pemerintah Malaysia
  15. Alat Musik Gamelan dari Jawa oleh Pemerintah Malaysia
  16. Tari Kuda Lumping dari Jawa Timur oleh Pemerintah Malaysia
  17. Tari Piring dari Sumatera Barat oleh Pemerintah Malaysia
  18. Lagu Kakak Tua dari Maluku oleh Pemerintah Malaysia
  19. Lagu Anak Kambing Saya dari Nusa Tenggara oleh Pemerintah Malaysia
  20. Kursi Taman Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Perancis
  21. Pigura Dengan Ornamen Ukir Khas Jepara dari Jawa Tengah oleh Oknum WN Inggris
  22. Motif Batik Parang dari Yogyakarta oleh Pemerintah Malaysia
  23. Desain Kerajinan Perak Desak Suwarti dari Bali oleh Oknum WN Amerika
  24. Produk Berbahan Rempah-rempah dan Tanaman Obat Asli Indonesia oleh Shiseido Co Ltd
  25. Badik Tumbuk Lada oleh Pemerintah Malaysia
  26. Kopi Gayo dari Aceh oleh perusahaan multinasional (MNC) Belanda
  27. Kopi Toraja dari Sulawesi Selatan oleh perusahaan Jepang
  28. Musik Indang Sungai Garinggiang dari Sumatera Barat oleh Malaysia
  29. Kain Ulos oleh Malaysia
  30. Alat Musik Angklung oleh Pemerintah Malaysia
  31. Lagu Jali-Jali oleh Pemerintah Malaysia
  32. Tari Pendet dari Bali oleh Pemerintah Malaysia

Sudah saatnya kita kembali meneguhkan sikap untuk peduli dan membangun kesadaran kultural secara kolektif untuk merebut kembali produk budaya yang telah dicaplok orang itu. Sebagai bangsa yang besar, kita jangan gampang menyerah dan bersikap permisif. Ayo, rebut kembali produk-produk budaya bangsa kita yang hilang itu. Kalau tidak sekarang, kapan lagi? ***

Read Full Post »

Marhaban ya RamadhanBulan yang sarat dengan berkah dan maghfirah yang sudah kita tunggu selama satu tahun itu akhirnya tiba juga. Ya, ya, ya, bulan ini tidak saja menjanjikan dan “memanjakan” rohaniah kita karena setiap amal yang baik akan mendapatkan pahala berlipat-lipat, tetapi juga melatih kita untuk bersikap sabar dan mampu mengapresiasi pengejawantahan sikap qanaah, sabar, dan menghargai sebuah proses.

Nah, selamat menyongsong kehadiran bulan suci Ramadhan, semoga kita semua dapat menunaikan kewajiban mulia itu sebulan peniuh. Mohon maaf lahir dan batin.

Read Full Post »

baronganKontes SEO bertema Mengembalikan Jati Diri Bangsa yang digelar BeritaJitu.com sungguh menarik diikuti. Bukan lantaran SEO-nya, melainkan temanya yang memang menantang untuk dikaji dan didiskusikan. Secara jujur, kita mesti mengakui, bahwa jati diri bangsa kita belakangan ini memang menampakkan potret buram. Nilai-nilai kesejatian diri bangsa yang dulu terekspresikan melalui sikap ramah, santun, setia kawan, gotong royong, dan sikap-sikap fatsun kehidupan yang lain, makin memudar di tengah meruyaknya sikap pragmatis, materialistis, konsumtif, dan hedonis. Sikap ke-kita-an telah berubah menjadi sikap ke-kami-an, bahkan dinilai telah terdegradasi ke dalam sikap ke-“aku”-an. Dalam konteks demikian, tidak berlebihan apabila perlu ada upaya serius untuk mengembalikan jati diri bangsa yang dinilai telah hilang itu.

Pada saat awal-awal kebangkitan nasional, persoalan ke-aku-an, etnisitas dan kesukuan melebur menjadi sebuah kekuatan dahsyat hingga mampu memercikkan semangat pembebasan dari nilai-nilai kolonialisme yang dengan amat sadar dilakukan oleh kaum penjajah. Tonggak kebangkitan nasionalisme itu juga telah merangsang tumbuhnya keinsyafan kolektif sebagai bangsa yang bermartabat, terhormat, dan berdaulat. “Rawe-rawe rantas, malang-malang putung”; begitulah adagium yang mampu memompakan semangat juang untuk menyatu dalam sebuah wadah kebersamaan menuju “Indonesia Baru”; Indonesia yang merdeka; bebas menentukan nasib sendiri; tanpa intervensi.

Nilai-nilai Kesejatian Diri yang Tererosi
Seiring dengan perubahan yang terus terjadi, sejak masa prakemerdekaan hingga pascakemerdekaan, nilai-nilai kesejatian diri itu dinilai juga mengalami pasang-surut. Dengan nada sedih, kita harus jujur mengakui bahwa nilai-nilai jati diri di negeri ini terus mengalami erosi. Tanpa bermaksud menjadikan nilai-nilai modernisme dan globalisme sebagai kambing hitam, disadari atau tidak, kita juga telah terperangkap, bahkan terjebak ke dalam nilai-nilai pragmatisme. Pergeseran nilai terus terjadi di segenap lapis dan lini kehidupan masyarakat. Semangat dan roh para pendiri negeri ini (nyaris) hanya memfosil dalam buku-buku sejarah dan museum. Selebihnya, kita telah “menuhankan” hal-hal yang pragmatis; politis dan ekonomis. Keinsyafan kolektif sebagai bangsa yang terhormat dan bermartabat, disadari atau tidak, telah menjelma menjadi kelatahan sikap yang memuja kebendaan dan kenikmatan semu. Bendera materialisme dan hedonisme terus berkibar di ranah-ranah publik. Secara kolektif, kita telah masuk perangkap pemujaan dan perhatian yang berlebihan terhadap interes-interes materiil dan praktis.

Yang menyedihkan, upaya pewarisan semangat jati diri selama ini dinilai telah tereduksi oleh kekuasaan. Pemberangusan buku-buku sejarah, misalnya, adalah sebuah contoh konkret betapa fakta-fakta sejarah menjadi demikian rentan terhadap penafsiran penguasa. Buku-buku sejarah yang dinilai tidak berpihak kepada penguasa dibrangus tanpa ampun. Bisa ditebak, yang terjadi kemudian adalah pembonsaian generasi dan anak-anak bangsa. Mereka sengaja dikerdilkan dan dihambat pertumbuhannya agar tak bisa bebas mengerti persoalan masa lalu yang pernah dialami oleh masyarakat dan bangsanya. Dalam kondisi demikian, tidak berlebihan apabila banyak anak-anak negeri ini yang tidak tahu sejarah yang benar mengenai jati diri bangsa dan negerinya sendiri.

Mengembalikan Jati Diri Bangsa
Kini, kita sudah merasakan atmosfer reformasi lebih dari satu dekade. Pertanyaan yang muncul adalah sudah adakah perubahan yang cukup bermakna dalam upaya mengembalikan jati diri bangsa yang dinilai telah tererosi itu? Lantas, bagaimana dengan bidang kebudayaan? Dengan nada sedih harus dikatakan bahwa budaya merupakan ranah yang tak tersentuh oleh reformasi, bahkan semenjak negeri ini berada di atas tungku kekuasaan Orde Baru. Kebudayaan benar-benar menjadi sebuah Indonesia yang tertinggal.

Lihatlah, betapa –meminjam istilah Slamet Sutrisno (1997) — semakin tidak intensnya seseorang dalam memburu jati diri yang lebih bermartabat. Perburuan gengsi yang berkembang dalam kelatahan membuat orang mengejar keberhasilan secara instan, entah melakukan korupsi atau usaha magis melalui cara mistis dalam memperoleh kekayaan. Pada hakikatnya mereka gemar menempuh terobosan dan “jalan kelinci” dengan sukses gaya “Abu Nawas”. Kursi empuk kepejabatan, titel, dan kedudukan keilmuan pun tak jarang disergap melalui kelancungan dalam ilmu permalingan”.

Agaknya, bangsa kita memang telah “ditakdirkan” untuk menjadi bangsa pelupa. Kita (nyaris) tak pernah belajar pada pengalaman-pengalaman masa silam. Yang sering kita ingat, bukan esensinya, melainkan asesorisnya. Kita lupa bahwa pada awal-awal pergerakan nasional, para pendiri negeri ini dengan amat sadar menyentuh persoalan kebudayaan sebagai basis perubahan dalam upaya menggapai jati diri. Kebudayaanlah yang telah menyatukan berbagai kelompok etnis dan suku ke dalam sebuah wadah, sehingga mampu menorehkan tinta sejarah melalui Gerakan Budi Utomo (1908) yang dikokohkan kembali melalui Sumpah Pemuda (1928). Berkat sentuhan kebudayaan, mimpi “Indonesia Baru” yang merdeka dan berdaulat akhirnya menjadi sebuah kenyataan.

Upaya mengembalikan jati diri bangsa itu agaknya hanya akan menjadi sebuah mimpi apabila ranah kebudayaan tak disentuh. Satu dekade lebih perjalanan reformasi seharusnya sudah mampu memberikan kemaslahatan publik dalam upaya mengembalikan jati diri yang dinilai telah hilang itu. Telinga kita sudah demikian jenuh mendengar bahasa politik dan ekonomi yang tak henti-hentinya mengedepankan “siapa yang menang” dan “apa untungnya”. Sudah saatnya kita memperluas makna perubahan dengan menyentuh akar-akar kebudayaan dengan mengedepankan pertanyaan “apa yang benar”.

Itulah yang selama ini kita lupakan sehingga lebih dari satu dekade reformasi belum juga menumbuhkan optimisme hidup dalam mengembalikan jati diri bangsa yang hilang. Kita merindukan “keinsyafan kolektif” untuk menyentuh kebudayaan sebagai salah satu dimensi kehidupan dalam menggapai kesejatian diri bangsa yang terhormat dan bermartabat. ***

Tulisan ini sekaligus juga sebagai bentuk dukungan terhadap tulisan “Mengembalikan Jati Diri Bangsa: Haruskah Menjadi Sebuah Utopia?” yang diikutsertakan dalam kontes SEO yang digelar oleh beritaJitu.com untuk yang pertama kalinya.

Read Full Post »

reyog ponorogo Sudah lama negeri kita dikenal sebagai sebuah bangsa yang kaya budaya. Keragaman budaya dengan corak multikultur-nya sudah menjadi brand yang mengagumkan. Banyak negeri lain yang merasa iri dengan kekayaan multikultur nusantara. Hampir setiap daerah memiliki nilai-nilai kearifan lokal yang diekspresikan secara kreatif dalam produk-produk budaya yang indah dan eksotis, hingga membentuk mozaik budaya yang memiliki daya pikat dan daya pesona tersendiri.

Namun, sungguh disayangkan, keragaman dan kekayaan budaya itu memiliki ketahanan yang (nyaris) rapuh. Tak sedikit produk budaya nusantara yang dengan mudah diklaim negeri lain. Berikut ini daftar kesenian dan budaya nusantara yang telah direbut oleh pihak lain yang saya peroleh dari sini.

No. Kesenian dan Budaya Asal Direbut Oleh
1. Batik Jawa Adidas
2. Naskah Kuno Riau Malaysia
3. Naskah Kuno Sumatra Barat Malaysia
4. Naskah Kuno Sulawesi Selatan Malaysia
5. Naskah Kuno Sulawesi Tenggara Malaysia
6. Rendang Sumatra Barat WN Malaysia
7. Sambal Bajak Jawa Tengah WN Belanda
8. Sambal Petia Riau WN Belanda
9. Sambal Nanas Riau WN Belanda
10. Tempe Jawa Perusahaan Asing
11. Lagu Rasa Sayang Sayange Maluku Malaysia
12. Tari Reog Ponorogo Jawa Timur Malaysia
13. Tari Soleram Riau Malaysia
14. Lagu Injit – Injit Semut Jambi Malaysia
15. Alat Musik Gamelan Jawa Malaysia
16. Tari Kuda Lumping Jawa Timur Malaysia
17. Tari Piring Sumatra Barat Malaysia
18. Lagu Kakak Tua Maluku Malaysia
19. Lagu Anak Kambing Saya Nusa Tenggara Malaysia
20. Kursi Taman dengan Ornamen Ukir Khas Jepara Jawa Tengah WN Perancis
21. Pigura dengan Ornamen Ukir Khas Jepara Jawa Tengah WN Inggris
22. Motif Batik Parang Yogyakarta Malaysia
23. Desain Kerajinan Perak Desa Suwarti Bali WN Amerika
24. Produk Berbahan Rempah – Rempah dan Tanaman Obat Asli Indonesia Shiseido Co. Ltd.

Sungguh memprihatinkan! Bisa jadi daftar tersebut akan masih terus bertambah panjang jika tak ada upaya serius untuk membuat sebuah pertahanan budaya yang kokoh.

Sebagai sebuah produk budaya, hasil-hasil kesenian dan kebudayaan nusantara ini akan ikut menjadi faktor penentu terhadap kedaulatan bangsa dan negara. Kita tak tahu pasti, apa yang sedang melintas di benak para pengambil kebijakan di negeri ini. Saya yakin, mereka bukannya tidak tahu kalau ketahanan budaya bangsa kita mengalami kerapuhan dan mengalami proses pembusukan dari waktu ke waktu. Kesibukan memburu kekuasaan dalam ranah politik bisa jadi telah membuat mereka abai terhadap persoalan-persoalan substansial yang seharusnya secepatnya tertangani.

Pada era “perang terbuka” di era virtual seperti sekarang ini, agaknya hanya bangsa yang memiliki kepekaan dan kecanggihan budaya yang akan tampil sebagai bangsa yang terhormat dan bermartabat. Secara jujur harus diakui, dalam soal yang satu ini, bangsa kita belum memiliki “kemauan politik” untuk menyentuhnya secara serius.

Langkah nyata yang harus segera dilakukan –meminjam istilah Dadan Suhandana– dan mungkin dilakukan adalah membentuk aturan perundang-undangan dalam negeri yang menyediakan kebutuhan pengelolaan keragaman budaya nasional. Perlindungan secara hukum perundang-undangan terhadap keragaman budaya nasional, selanjutnya dapat dijadikan pijakan dasar untuk menjaga kedaulatan bangsa sehingga bisa diakui di dunia internasional. Lebih jauh, harus ada sebuah kesadaran dan pengakuan oleh dunia internasional bahwa perundang-undangan akan kepemilikan Negara terhadap ekspresi budaya, sangat diperlukan oleh Indonesia guna menjaga ketahanan nasional dan kedaulatan negaranya. Hal ini tentunya bisa dijadikan momentum bersama bangsa Indonesia dalam memaknai Kebangkitan Nasional yang baru, yang diwujudkan dalam tindakan nyata dalam menegakkan kedaulatan bangsa melalui Konsep Pertahanan Budaya. Sudah saatnya kini bangsa Indonesia membuat suatu perlindungan hukum semisal Paten Negara atau yang lebih jauh Pengakuan Internasional bagi Ekspresi Budaya Bangsa Indonesia.

Semoga saja kepekaan para pengambil kebijakan terhadap masalah ketahanan budaya itu masih ada dan terus menggelora dari waktu ke waktu. Jangan sampai baru berteriak setelah semua ketahanan budaya negeri ini lumpuh dan tak berdaya. ***

Read Full Post »

Kita masih belum juga bisa memahami mengapa kekerasan demi kekerasan terus berlangsung di negeri ini. Belum reda sebuah aksi kekerasan tertangani, sudah muncul kasus kekerasan lain yang jauh lebih pelik dan kompleks. Terakhir, Jumat pagi, 17 Juli 2009, sekitar pukul 07.45 dan 07.48 WIB, dua bom meledak di dua tempat yang berbeda pada saat yang hampir bersamaan, yaitu Hotel JW Marriott di kawasan Mega Kuningan dan Hotel Ritz Carlton di kawasan SBCD. Akibatnya jatuh puluhan korban luka dan beberapa korban tewas, sebagiannya adalah warga asing. Insiden ini jelas makin memperpanjang daftar kasus teror bom yang pernah mengoyak imaji sebagai bangsa yang santun, terhormat, dan bermartabat.

Berikut ini beberapa rekaman video dari youtube yang memperlihatkan kronologi tragedi memilukan itu.





Sebagai bangsa yang sudah lama merdeka, seharusnya kita bisa banyak belajar dari kasus-kasus kekerasan yang pernah terjadi. Upaya serius untuk menanganinya perlu dilakukan secara komprehensif dan tidak parsial.

Banyak kalangan berpendapat bahwa aksi teror bom ini sangat erat kaitannya dengan doktrin Islam garis keras yang konon suka menggunakan budaya kekerasan sebagai media jihad dalam platform perjuangannya. Hmmm … sepanjang pemahaman awam saya, Islam tak pernah mengajarkan kekerasan. Bahkan, Islam selalu berupaya mengajarkan nilai kasih sayang kepada sesamanya. Ini artinya, dengan dalih apa pun, Islam tak akan pernah menolerir kekerasan di sebuah negeri yang sudah lama merdeka. Kalau toh itu benar dilakukan orang yang memiliki doktrin garis keras atau apa pun istilahnya, mestinya bukan Islam yang dituding, melainkan pelakunya.

Kita berharap, semoga teror bom yang mengguncang Jakarta menjadi peristiwa tragis yang terakhir kalinya, dan menjadi starting point bagi negeri ini dalam meretas budaya kekerasan yang belakangan ini mulai menggejala di berbagai lapis dan lini kehidupan. Apa pun alasannya, kekerasan dan teror hanya akan menumbuhkan segudang konflik yang akan terus melahirkan rentetan konflik-konflik berikutnya. ***

Read Full Post »

awardEntah, sejak kapan tradisi itu berawal. Siapa pengagas awalnya juga tak jelas benar. Yang pasti, pemberian award antarbloger di kompleks blogosphere makin marak sejak dua tahun belakangan ini. Bagi saya, pemberian award semacam ini merupakan wujud penghargaan dan apresiasi antarsesama bloger sesuai dengan hakikatnya sebagai makhluk sosial seperti halnya dalam dunia nyata.

Di kompleks blogosphere, bloger juga punya keinginan yang kuat untuk membangun ikatan-ikatan sosial secara maya. Budaya silaturahmi dan saling berkunjung di rumah maya menjadi salah satu aktivitas yang sering dilakukan seorang bloger. Situasi semacam ini, diakui atau tidak, telah menumbuhkan ikatan emosional antarbloger sehingga proses aktualisasi diri di dunia maya bisa makin eksis dan legitimate.

Demikian juga halnya dengan saya *halah*. Sebagai salah satu bagian kecil dari masyarakat maya, saya sudah beberapa kali menerima award dari beberapa sahabat bloger. Terakhir, saya menerima award dari Mas Morishige. Untuk itu, saya ucapkan terima kasih kepada Mas Morishige yang telah berkenan memberikan award itu buat saya sehingga makin menambah koleksi dalam pundi-pundi award saya, hehe …

Menurut Mas Morishige, award ini diberi nama Nice Visitor Award. Dia mendapatkannya dari si Riffy ini dibikin oleh sisternya, Jiyy. “Dibuat khusus buat setiap blogger yang datang berkunjung ke sebuah blog dan dianggap sebagai visitor yang menyenangkan. Entah karena rajin leave comment atau pernah memberi komentar yang berkesan,” tuturnya.

Konon, penerima award ini mesti mematuhi aturan main seperti berikut ini.
1. give this award ke 3 blogger yang menurud kamu pantas nerima award ini .
2. kasih tahu siapa yang ngasih. jangan lupa, masukan link si pemberi ya?
3. tinggalkan komentar ke blogger yang menerima award ini.
4. pajang gambarnya di postingan kamu!!! lebih baik jika mengambil kode HTML-nya di sini.
5. cantumin link gue and link sista gue di postingan kamu !!!
(Bahasa sesuai dengan url aslinya, hehe ….).

Karena hanya 3 bloger yang boleh menerima award, saya ingin memberikan award lanjutan ini kepada sahabat-sahabat bloger Kendal yang lumayan eksis hadir di kompleks blogosphere, yakni:
Pak Marsudiyanto
Pak Wandi
Pak Sholeh

Sebenarnya di Kendal sudah ada beberapa bloger yang eksis melakukan aktivitas ngeblog dan layak mendapatkan award dari sesama bloger Kendal sendiri. Namun, apa daya, konon, aturan main mesti dijalankan, hiks. Ok, ya gitu, deh! Terima kasih semuanya. ***

Read Full Post »

petaindonesiaKita memang sudah menghirup udara kemerdekaan lebih dari 60 tahun. Jika dianalogikan dengan usia manusia, negeri ini bisa dibilang cukup tua. Wajahnya sudah mulai tampak keriput. Tenaganya seringkali sempoyongan ketika memanggul beban. Namun, dari sisi pengalaman hidup, jelas sudah banyak dinamika kehidupan yang dilaluinya. Dalam kondisi demikian, idealnya negeri ini sudah memiliki kematangan dan kedewasaan sikap dalam menentukan nilai-nilai kearifan dan fatsun kehidupan yang bisa diwariskan dari generasi ke generasi dalam mencapai kemajuan dan kualitas hidup bangsa.

Meski demikian, secara jujur mesti diakui, semakin bertambahnya usia, bangsa kita justru semakin dihadapkan pada persoalan-persoalan kebangsaan yang makin rumit dan kompleks. Bangsa kita tak hanya dihadapkan pada persoalan-persoalan eksternal ketika dunia sudah menjadi sebuah “perkampungan global”, tetapi juga dihadapkan pada persoalan-persoalan internal yang justru makin menambah beban bangsa makin berat. Silang-sengkarutnya persoalan ekonomi, masih banyaknya kasus “mafia” peradilan yang menghambat supremasi hukum, sistem pendidikan yang masih amburadul, wajah demokrasi yang sarat “pembusukan”, atau berbagai fenomena anomali sosial yang marak terjadi di berbagai lapis dan lini kehidupan masyarakat, merupakan beberapa contoh fenomena betapa negeri ini telah kehilangan nilai-nilai kearifan dan fatsun kehidupan. Tidak berlebihan jika dinamika kehidupan negeri ini terkesan stagnan, bahkan mengalami set-back jauh ke belakang.

Homo Violens
Yang lebih mencemaskan, negeri ini dianggap telah kehilangan nilai-nilai kesejatian diri sebagai bangsa yang terhormat dan bermartabat akibat meruyaknya aksi-aksi kekerasan dan vandalisme yang tak henti-hentinya menggoyang sendi-sendi kehidupan berbangsa dan bernegara. Bangsa kita yang multikultur dan multiwajah dinilai telah kehilangan sikap ramah. Nilai-nilai keberadaban telah tereduksi oleh sikap-sikap kebiadaban yang membudaya dalam bentuk tawuran pelajar, pemerkosaan, pembunuhan, mutilasi, aborsi, dan berbagai perilaku vandalistis lainnya yang menggurita di segenap lapis dan lini kehidupan masyarakat. Sentimen-sentimen primordialisme berbasis kesukuan, agama, ras, atau antargolongan menjadi demikian rentan tereduksi oleh emosi-emosi agresivitas. Bangsa kita seolah-olah telah menjelma menjadi “homo violens” yang menghalalkan darah sesamanya dalam memanjakan naluri dan hasrat purbanya.

Memang bukan hal yang mudah untuk memutus mata rantai kekerasan sebagai ekspresi bangsa yang “murka” akibat pasungan rezim masa lalu yang bertahun-tahun lamanya “memenjarakan” anak-anak bangsa dalam tungku kekuasaan yang dianggap tertutup, tiran, dan tidak adil. Kesenjangan sosial-ekonomi yang begitu lebar, disadari atau tidak, telah membuat kehidupan masyarakat di lapisan akar rumput menjadi gampang putus asa dan rentan terhadap aksi-aksi kekerasan. Para pakar sosiologi mengemukakan bahwa tekanan ekonomi yang berat bisa menjadikan seseorang atau kelompok sosial tertentu mengalami frustrasi akibat merasa tersingkir dari persaingan hidup komunitasnya. Imbasnya, jika mereka mendapatkan kesempatan untuk melampiaskan frustrasinya, aksi kekerasan dan kerusuhan sosial menjadi cara yang jitu dan “sah” bagi mereka. Lebih-lebih gaya hidup orang kaya baru (the new rich) yang pamer kekayaan, sungguh mempraktekkan pola hidup konsumtif yang kontras secara diametral dengan hidupnya yang serba tertekan, maka kemungkinan terjadinya konflik dan kerusuhan semakin terbuka.

Pembangunan ekonomi negeri kita yang telah berlangsung sejak rezim Orde Baru dinilai telah melahirkan suatu kelompok sosial yang konsumtif. Mereka tinggal di kota-kota besar, mengonsumsi sekitar lebih dari sepertiga pendapatan nasional, amat gemar berbelanja, memiliki rumah dan mobil-mobil mewah, bergaya hidup glamor, menjadi anggota berbagai klub eksekutif yang mahal, tetapi cenderung bersikap cuek pada gagasan-gagasan perubahan. Manusia modem, dalam pandangan Hembing Wijayakusuma (1997), telah melupakan satu dari dua sisi yang membentuk eksistensinya akibat keasyikan pada sisi yang lain. Kemajuan industri telah mengoptimalkan kekuatan mekanismenya, tetapi melemahkan kekuatan rohaninya. Manusia telah melengkapinya dengan alat-alat industri dan ilmu pengetahuan eksperimental dan telah meninggalkan hal-hal positif yang dibutuhkan bagi jiwanya. Akar-akar kerohanian sedang terbakar di tengah api hawa nafsu, keterasingan, kenistaan, dan ketidakseimbangan.

Akibat pemahaman pola hidup yang salah semacam itu, disadari atau tidak, telah melumpuhkan kepekaan nurani dan moral serta religi. Sikap hidup instan telah melenyapkan budaya “proses” dalam mencapai sesuatu. Sikap sabar, tawakal, ulet, telaten, dan cermat, yang merupakan entitas kebersahajaan dan kejujuran telah tersulap menjadi sikap menerabas, pragmatis, dan serba cepat. Orang pun jadi semakin permisif terhadap perbuatan-perbuatan yang tidak jujur di sekitarnya. Budaya suap, kolusi, nepotisme, atau manipulasi anggaran sudah dianggap sebagai hal yang wajar. Untuk mengegolkan ambisi tidak jarang ditempuh dengan cara-cara yang tidak wajar menurut etika. Kesibukan memburu gebyar materi untuk bisa memanjakan selera dan naluri konsumtifnya, membuat kepedulian terhadap sesama menjadi marginal. Jutaan saudara kita yang masih bergelut dengan lumpur kemiskinan, kelaparan, dan keterbelakangan, luput dari perhatian.

Ranah Pendidikan
“Historia est Magistra Vitae”, demikian ungkapan Latin yang nyaring terdengar itu. Ya, sejarah adalah guru kehidupan. Berkaca pada lintasan sejarah dari generasi ke generasi, sudah saatnya bangsa kita kembali memburu dan menemukan kesejatian diri sebagai bangsa yang terhormat dan bermartabat. Temukan kembali sikap ramah itu menjadi entitas karakter bangsa yang telah lama hilang, untuk selanjutnya diapresiasi dan menjadi laku utama dalam kehidupan sehari-hari.

Ramah, menurut Kamus Besar Bahasa Indonesia, mengandung arti: “baik hati dan menarik budi bahasanya; manis tutur kata dan sikapnya; suka bergaul dan menyenangkan dalam pergaulan.” Beranjak dari pengertian ini, sikap ramah jelas akan memberikan nilai tambah buat bangsa yang kini tengah memasuki peradaban yang “sakit” dan sarat dengan berbagai pembusukan yang bisa mengikis kesejatian diri bangsa. Oleh karena itu, menggali dan merevitalisasi nilai-nilai keramahan menjadi hal yang niscaya dilakukan oleh segenap komponen bangsa. Sikap ramah juga akan mampu menanggalkan sikap-sikap congkak, dendam, dan kebencian, yang selama ini benar-benar telah membuat bangsa kita terpuruk ke dalam kubangan stagnasi dan situasi yang serba chaos. Sangat beralasan ketika bangsa lain sudah melaju mulus di atas “jalan tol” peradaban dunia, bangsa kita justru masih bersikutat di balik semak-belukar lantaran sibuk menaburkan bibit-bibit dendam dan kebencian terhadap sesamanya.

Akar kekerasan yang membelit sendi-sendi kehidupan bangsa tentu saja tidak lahir begitu saja. Sistem pendidikan kita yang belum efektif dalam melahirkan generasi-generasi masa depan yang cerdas sekaligus bermoral yang kemudian “berselingkuh” dengan kultur sosial masyarakat kita yang sedang chaos dan “sakit” setidaknya telah memiliki andil yang cukup besar dalam menciptakan lingkaran kekerasan itu.

Fungsi pendidikan nasional untuk mengembangkan kemampuan dan membentuk watak serta peradaban bangsa yang bermartabat dalam rangka mencerdaskan kehidupan bangsa, bertujuan untuk berkembangnya potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada Tuhan Yang Maha Esa, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri, dan menjadi warga negara yang demokratis serta bertanggung jawab –sebagaimana termaktub dalam pasal 3 UU Sisdiknas– (nyaris) hanya menjadi slogan ketika kultur sosial masyarakat dinilai tidak cukup kondusif dalam mendukung terciptanya atmosfer pendidikan yang nyaman dan mencerahkan.

Nilai-nilai luhur baku yang digembar-gemborkan di lembaga pendidikan (nyaris) tak bergema dalam gendang nurani siswa didik ketika berbenturan dengan kenyataan sosial yang chaos dan “sakit”. Nilai-nilai kesantunan dan keberadaban telah terkikis oleh meruyaknya perilaku-perilaku anomali sosial yang berlangsung di tengah panggung kehidupan masyarakat. Ketika guru menanamkan nilai-nilai moral dan religi, para siswa harus melihat kenyataan, betapa masyarakat kita demikian gampang kalap dan lebih mengedepankan emosi ketimbang logika dan hati nurani dalam menyelesaikan masalah. Nilai-nilai kearifan dan kesantunan telah terbonsai menjadi perilaku yang sarat darah dan kekerasan. Ketika guru menanamkan nilai-nilai kejujuran, betapa anak-anak masa depan negeri ini harus menyaksikan banyaknya kaum elite yang tega melakukan pembohongan publik, manipulasi, atau korupsi. Hal itu diperparah dengan tersingkirnya anak-anak miskin dari dunia pendidikan akibat ketiadaan biaya.

Sampai kapan pun lingkaran kekerasan di negeri ini tidak akan pernah bisa terputus apabila tidak didukung oleh atmosfer dunia pendidikan yang nyaman dan mencerahkan serta kultur sosial yang kondusif. Oleh karena itu, sudah selayaknya fenomena kekerasan ini mendapatkan perhatian serius dari semua komponen bangsa untuk menghentikannya. Para elite negeri, tokoh-tokoh masyarakat, pemuka agama, orang tua, atau pengelola media, perlu bersinergi untuk bersama-sama membangun iklim kehidupan yang nyaman dan mencerahkan di berbagai lapis dan lini kehidupan masyarakat. Demikian juga dari ranah hukum. Perlu diciptakan efek jera kepada para pelaku kekerasan agar tidak terus-terusan mewabah dan memfosil dari generasi ke generasi.

Selain itu, idealnya lingkungan keluarga juga harus memiliki filter yang kuat terhadap gencarnya arus perubahan yang tengah berlangsung. Dalam konteks demikian, peran orang tua menjadi amat penting dan vital dalam memberdayakan moralitas anak. Orang tualah yang menjadi referensi utama ketika anak-anak sedang tumbuh dan berkembang. Idealnya, orang tua mesti bisa menjadi “patron” teladan. Anak-anak sangat membutuhkan figur anutan moral dari orang tuanya sendiri, yang tidak hanya pintar “berkhotbah”, tetapi juga mampu memberikan contoh konkret dalam bentuk perilaku, sikap, dan perbuatan.

Masyarakat juga harus mampu menjalankan perannya sebagai kekuatan kontrol yang ikut mengawasi perilaku kaum remaja kita. “Deteksi” dini terhadap kemungkinan munculnya perilaku kekerasan mutlak diperlukan. Potong secepatnya jalur agresivitas yang kemungkinan akan menjadi “jalan” bagi penganut “mazab” kekerasan dalam menyalurkan naluri agresivitasnya. Ini artinya, dibutuhkan sinergi yang kuat antara dunia pendidikan, orang tua, tokoh-tokoh masyarakat, tokoh-tokoh agama, dan para pengambil kebijakan untuk bersama-sama peduli terhadap perilaku kekerasan yang (nyaris) menjadi budaya baru di negeri ini.

Sungguh, kita sangat merindukan Indonesia yang multiwajah dan multikultur serta memiliki nilai-nilai kearifan lokal yang begitu beragam itu ditaburi dengan nilai-nilai keramahan, kearifan, dan fatsun kehidupan di segenap lapis dan lini kehidupan masyarakat. Jangan sampai terjadi pesona kekerasan, arogansi kekuasaan, dan emosi-emosi agresivitas purba yang serba naif, sebagaimana disindir W.S. Rendra dalam “Sajak Seorang Tua di Bawah Pohon” berikut ini menjadi “fosil” yang makin memperkuat stigma bangsa kita sebagai bangsa bar-bar dan biadab.

………………………………………
Aku mendengar bising kendaraan.
Aku mendengar pengadilan sandiwara.
Aku mendengar warta berita.
Ada gerilya kota merajalela di Eropa.
Seorang cukong bekas kaki tangan fasis,
seorang yang gigih, melawan buruh,
telah diculik dan dibunuh,
oleh golongan orang-orang yang marah.
Aku menatap senjakala di pelabuhan.

Kakiku ngilu,
dan rokok di mulutku padam lagi.
Aku melihat darah di langit.
Ya! Ya! Kekerasan mulai mempesona orang.
Yang kuasa serba menekan.
Yang marah mulai mengeluarkan senjata.
Bajingan dilawan secara bajingan.

Ya! Inilah kini kemungkinan yang mulai menggoda orang.
Bila pengadilan tidak menindak bajingan resmi,
maka bajingan jalanan yang akan diadili.
Lalu apa kata nurani kemanusiaan?
Siapakah yang menciptakan keadaan darurat ini?
Apakah orang harus meneladan tingkah laku bajingan resmi?
Bila tidak, kenapa bajingan resmi tidak ditindak?
Apakah kata nurani kemanusiaan?

O, Senjakala yang menyala!
Singkat tapi menggetarkan hati!
Lalu sebentar lagi orang akan mencari bulan dan bintang-bintang!

O, gambaran-gambaran yang fana!
Kerna langit di badan yang tidak berhawa,
dan langit di luar dilabur bias senjakala,
maka nurani dibius tipudaya.
Ya! Ya! Akulah seorang tua!
Yang capek tapi belum menyerah pada mati.
Kini aku berdiri di perempatan jalan.
Aku merasa tubuhku sudah menjadi anjing.
Tetapi jiwaku mencoba menulis sajak.
Sebagai seorang manusia.

Pejambon, 23 Oktober 1977
(“Sajak Seorang Tua di Bawah Pohon” karya W.S. Rendra dalam Potret Pembangunan dalam Puisi)

Nah, bagaimana? ***

Read Full Post »

(Mengawal dinamika reformasi)

Kebangkitan nasional adalah masa bangkitnya semangat persatuan, kesatuan, dan nasionalisme serta kesadaran untuk memperjuangkan kemerdekaan Indonesia, yang sebelumnya tidak pernah muncul selama penjajahan 350 tahun. Masa ini diawali dengan dua peristiwa penting Boedi Oetomo (1908) dan Sumpah Pemuda (1928). Masa ini merupakan salah satu dampak politik etis yang mulai diperjuangkan sejak masa Multatuli.

Tokoh-tokoh kebangkitan nasional, antara lain: Sutomo, Gunawan, dan Tjipto Mangunkusumo, dr. Tjipto Mangunkusumo, Suwardi Suryoningrat (Ki Hajar Dewantara), dr. Douwes Dekker, dll

Selanjutnya pada 1912 berdirilah partai politik pertama Indische Partij. Pada tahun ini juga Haji Samanhudi mendirikan Sarekat Dagang Islam (Solo), KH Ahmad Dahlan mendirikan Muhammadiyah (Yogyakarta) dan Dwijo Sewoyo dan kawan-kawan mendirikan Asuransi Jiwa Bersama Bumi Putera di Magelang.

(lebih…)

Read Full Post »

Oleh: Sutamat Arybowo
(Peneliti LIPI dan Anggota Asosiasi Tradisi Lisan)

Pada suatu hari di rumah elite desa sedang berduka karena putra tertuanya mengalami kecelakaan lalu lintas hingga meninggal dunia. Warga desa kumpul melayat dan mempersiapkan upacara pemakaman jenazah. Beberapa warga desa hilir-mudik dan sebagian duduk berjejer di tempat yang sudah disediakan di halaman rumah. Dalam keadaan mulai sunyi, di tengah kerumunan jenazah, datanglah seorang laki-laki tua, usianya lebih kurang 75 tahun, mengenakan baju kurung lengan panjang warna hitam, dengan celana selutut berwarna hitam pula. Sarungnya diselempangkan di bahu sebelah kiri dan capingnya yang terbuat dari daun lontar dibuka lalu ditempelkan di dada kiri, dan di atas kepala mengenakan udeng (ikat kepala) motif batik warna hitam kecoklatan. Dengan percaya diri ia masuk ke rumah menuju ke tempat jenazah disemayamkan. Tanpa menoleh ke kanan atau ke kiri, ia seolah tak kenal siapa pun para tamu yang duduk di situ.

Setelah tiba di depan jenazah, ia membuka tutup bagian atas sembari menatap wajahnya. Lalu ia mengatakan, “Sedulur, asalmu ora ono/Terus dadi ono/Saiki ora ono maneh/Yo wis, tak dongak-ke slamet.” (Saudara, asalmu tidak ada/Lalu menjadi ada/Sekarang tidak ada lagi/Ya sudah, saya doa kan selamat.)

Kemudian tutup jenazah dikembalikan seperti semula, lalu ia mundur pelan-pelan sampai ke pintu rumah dengan membalikkan arah dan menuju ke halaman rumah. Setelah itu ia ikut duduk bersama-sama tamu yang lain. Ia memilih duduk di pinggir dekat pintu masuk menuju rumah sehingga beberapa warga banyak yang kenal. Pada saat ketemu orang lain yang menyapanya, ia selalu mengatakan sedulur, yang maknanya sama-sama saudara.

Perilaku kultural seperti itu dikategorikan sebagai orang apa? Bagaimana ia menghayati hubungan individu dirinya dengan sesama, dengan alam semesta, dan dengan Sang Pencipta? Sudah banyak tulisan tentang masyarakat Samin, bahkan ada yang menganggapnya sebagai simbol perlawanan terhadap kekuasaan dari zaman kolonial Belanda hingga saat ini. Beberapa informasi mengatakan bahwa Saminisme sebagai sebuah sejarah perlawanan terhadap kekuasaan telah diubah menjadi deskripsi kebudayaan.

Jujur dan pemurah
Sejak dikenal umum dari zaman kolonial Belanda, orang Samin tinggal menyebar di daerah Bojonegoro, Tuban, Blora, Rembang, Grobogan, Pati, dan Kudus. Mereka berdomisili tidak menggerombol, melainkan terpencar-pencar, misalnya, tiap desa terdapat 5-6 keluarga, tetapi solidaritas sosialnya menyatu. Orang Samin memiliki rasa religi yang kuat sehingga sering kali membuat para pendatang (tamu) merasa risi dan malu karena mereka sangat jujur, serta pemurah terhadap para tamu. Seluruh makanan yang mereka simpan disajikan kepada tamunya dan tidak pernah memikirkan berapa harganya. Masyarakat Samin memiliki jiwa yang polos dan terbuka. Mereka berbicara menggunakan bahasa Kawi dan bercampur bahasa Jawa ngoko dan sering kedengaran kasar.

Dalam pergaulan sehari-hari, baik dengan keluarganya, sesama pengikut ajaran, maupun dengan orang lain yang bukan pengikut Samin, orang Samin selalu beranjak pada eksistensi mereka yang sudah turun-temurun dari pendahulunya, yaitu Ono niro mergo ningsun, ono ningsun mergo niro. (Adanya saya karena kamu, adanya kamu karena saya.) Ucapan itu menunjukkan bahwa orang Samin sesungguhnya memiliki solidaritas yang tinggi dan sangat menghargai eksistensi manusia sebagai makhluk individu, sekaligus sebagai makhluk sosial. Karena itu, orang Samin tidak mau menyakiti orang lain, tidak mau petil jumput (tidak mau mengambil barang orang lain yang bukan haknya), tetapi juga tidak mau dimalingi (haknya dicuri).

Semua perbuatan mereka berawal dari baik, maka berakhirnya juga harus baik, begitulah ringkasnya. Bagi orang lain yang tidak memahami eksistensi orang Samin, mereka bisa jadi menyebutnya sebagai Wong Sikep, yang artinya orang yang selalu waspada. Atau disebut juga Wong Kalang karena orang lain akan menganggap ketidakrasionalan pikiran, keeksentrikan perilaku, dan ketidaknormalan bahasa. Tetapi, bagi sesama orang Samin selalu menyebut kepada orang lain Sedulur Tuwo.

Ini pun tampak di dalam ia merenung dan berdoa kepada “Adam”, selalu minta keselamatan untuk dirinya, sesama makhluk alam semesta, dan juga Sang Pencipta sendiri. Ungkapan Sedulur Tuwo tak pernah ditinggalkan. Doa orang Samin juga selalu berhubungan dengan keadaan ekologi dan ekosistem di mana mereka berdomisili. Orang Samin yang tinggal di daerah Desa Klopo Duwur, Kecamatan Randu Blatung, Kabupaten Blora, misalnya, menunjukkan secara siklus hubungan antarmanusia sebagai pribadi, antarsesama manusia, antara manusia dan alam lingkungan. Pandangannya terhadap ekologi dan ekosistem tersebut dapat dijumpai dalam ucapannya, seperti: Banyu podo ngombe/Lemah podo duwe/Godong podo gawe. (Air sama-sama diminum/Tanah sama-sama punya/Daun sama-sama memanfaatkan.)

Ucapan itu oleh pengikut Samin ditafsirkan secara bijak, maksudnya bumi, air, dan kekayaan alam yang terkandung di dalamnya perlu dijaga. Tidak berarti sama rasa, sama rata, seperti tuduhan orang lain di luar komunitas Samin. Dalam praktiknya, mereka justru ikut menjaga pelestarian kayu jati di daerah Blora. Mereka hanya memanfaatkan daunnya untuk keperluan sehari-hari dan rantingnya untuk keperluan masak-memasak. Hal itu sudah berjalan sejak leluhur mereka masa lalu dan mereka tidak mau merusak hutan. Berdasarkan pandangan seperti itu, tampaknya orang lain sering kali menerjemahkan kata “Samin” sama dengan Sami-sami Amin.

Sejak masa kolonial
Pada mulanya ajaran orang Samin ini berasal dari seorang tokoh yang bernama Kiai Samin Surosentiko, yang lahir di Ploso, wilayah Blora, Jawa Tengah, tahun 1859. Ia ditangkap oleh Pemerintah Hindia Belanda karena tidak mau membayar pajak dan tidak mau ikut kerja paksa. Seperti tokoh perintis kemerdekaan Indonesia yang lain, ia dibuang ke Sawahlunto, Sumatera Barat, hingga wafat tahun 1914. Namun, ajarannya masih dianut oleh pengikutnya hingga sekarang di beberapa daerah yang disebutkan di atas. Beberapa catatan kolonial Belanda menyebut bahwa Kiai Samin Surosentiko dianggap sebagai pembangkang, pemberontak, selalu melawan pemerintah. Oleh karena itu, ajarannya tidak boleh disebarluaskan dan oleh mainstream agama pada saat itu dianggap sesat, lalu mau tidak mau ia harus diasingkan dari pengikutnya.

Dalam kaitannya dengan deskripsi singkat ini, maka nilai tradisi yang dapat dipetik adalah bagaimana strategi ajaran orang Samin dalam mengimplementasikan kehidupan sehari-hari. Misalnya, mereka antikekerasan, jujur, terbuka, dan tidak mau menyakiti orang lain. Orang Samin mengejawantahkan kehidupan dengan solidaritas sosial. Juga pada zaman Orde Baru, ketika mereka menggunakan kiat atau strategi ngumumi; tidak melawan pemerintah, tetapi mengkritisi secara pasif.

Mereka memang tidak mau ikut program KB karena sudah punya cara sendiri. Mereka juga tidak ikut program Bimas-Inmas dan tidak mau terima kredit dari BRI supaya tidak ngemplang. Orang Samin bikin pupuk sendiri, bikin irigasi sendiri. Pendeknya, dalam hidup, mereka tidak bergantung kepada teknologi maju. Orang Samin benar-benar sebuah contoh kasus komunitas yang benar-benar memiliki kemandirian. Oleh karena itu, masyarakat Samin tidak mengenal krisis ekonomi dan moneter. ***

http://www.kompas.com/kompas-cetak/0705/10/humaniora/3522042.htm

Read Full Post »

Ajaran Samin (Saminisme) yang disebarkan oleh Samin Surosentiko (1859-1914), adalah sebuah konsep penolakan terhadap budaya kolonial Belanda dan penolakan terhadap kapitalisme yang muncul pada masa penjajahan Belanda abad ke-19 di Indonesia. Sebagai gerakan yang cukup besar Saminisme tumbuh sebagai perjuangan melawan kesewenangan Belanda yang merampas tanah-tanah dan digunakan untuk perluasan hutan jati.

Asal ajaran Saminisme
Ajaran Saminisme muncul sebagai akibat atau reaksi dari pemerintah kolonial Belanda yang sewenang-wenang.Perlawanan dilakukan tidak secara fisik tetapi berwujud penentangan terhadap segala peraturan dan kewajiban yang harus dilakukan rakyat terhadap Belanda misalnya dengan tidak membayar pajak. Terbawa oleh sikapnya yang menentang tersebut mereka membuat tatanan, adat istiadat dan kebiasaan-kebiasaan tersendiri.

Tokoh perintis ajaran Samin
Tulisan ini merupakan salah satu dari teks historis-sosiologis yang mencoba disuguhkan untuk mengenal suatu masyarakat secara komprehensif dan mendalam. Dalam tulisan ini akan diuraikan tentang masyarakat samin meliputi; ide terbentuknya masyarakat samin, tiga unsur gerakan Saminisme, masa kepemimpinannya, sumber ajaran Samin, daerah persebaran ajaran Samin, sebab perlawaan orang Samin, pandangan orang Samin terhadap pemimpinnya, potret pemuka masyarakat Samin saat ini, bahasa yang digunakan, kepribadian orang Samin, rites perkawinan orang Samin, pandangan orang Samin pada sebuah nasib, identitas pakaiannya, perkembangan kepercayaannya, dan strategi politik orang Samin.

Tulisam ini diharapkan menjadi suguhan kepada pembaca secara berbeda, karena sampai saat ini masih kentalnya pengetahuan masyarakat akan Orang Samin tidak beda dengan masyarakat yang terbelakang, terisolir dan anti kemajuan. Karena penulis khawatir dari kesekian kalinya kekerasan pada pemeluk aliran kepercayaan sering dipertontontan, dan sangat mungkin terjadi pada pada entitas masyarakat samin.

Tulisan ini merujuk dari berbagai sumber, termasuk buah tangan Sastroatmodjo (2003), film dokumenter mas Arto di Studio 12 Ungaran, dan hasil diskusi hasil KKL (Kuliah Kerja Lapangan) pada saat duduk di bangku kuliah di Program Studi Pendidikan Sosiologi & Antropologi Unnes.

Otak intelektual gerakan Saminisme adalah Raden Surowijoyo. Pengetahuan intelektual Kyai Samin ini di dapat dari ayahanda, yaitu anak dari pangeran Kusumaniayu (Bupati Sumoroto, yaitu kawasan distrik pada kabupaten Tulungagung Jawatimur). Lelaki kelahiran tahun 1859 di Ploso ini sejak dini dijejali dengan pandangan-pandangan viguratif pewayangan yang mengagungkan tapabrata, gemar prihatin, suka mengalah (demi kemenangan akhir) dan mencintai keadilan. Beranjak dewasa, dia terpukul melihat realitas yang terjadi, dimana banyaknya nasib rakyat yang sengsara, dimana Belanda pada saat itu sangat rajin melakukan privatisasi hutan jati dan mewajibkan rakyat untuk membayar pajak. Pada saat itulah, Raden Surowijoyo melakukan perampokan pada keluarga kaya dan hasilnya dibagi-bagi kepada fakir miskin. Dia juga menghimpun para brandalan di Rajegwesi dan Kanner yang dikemudian hari menyusahkan pihak Gupermen. Pada saat itulah, Kyai keturunan bangsawan ini dikenal oleh masyarkat kecil dengan sebutan Kyai Samin yang berasal dari kata “sami-sami amin” yang artinya rakyat sama-sama setuju ketika Raden Surawijoyo melakukan langkah membrandalkan diri untuk membiayai pembangunan unit masyarakat miskin. Kyai Samin Surosantiko tidak hanya melakukan gerakan agresif revolusioner, dia juga melakukan ekspansi gagasan dan pengetahuan sebagai bentuk pendekatan transintelektual kaum tertindas (petani rakyat jelata) dengan cara ceramah dipendopo-pendopo pemerintahan desa. Isi dari ceramah ini yaitu keinginan membangun kerajaan Amartapura. Adapun pesan substantif yang didengung-dengungkan yaitu meliputi; jatmiko (bijaksana) dalam kehendak, ibadah, mawas diri, mengatasi bencana alam dan jatmiko selalu berpegangan akan budi pekerti.

Namun akhir pergerakan dari Kyai Samin Surosantiko di cekal oleh Belanda dan dibuang di Tanah Lunto pada tahun 1914, yang belum sempat mengaktualisasikan seluruh ide-idenya. Bukan hanya otak pergerakannya, bahkan kitab orang Samin yang ditulisnya juga di sita yang berjudul Serat Jamus Kalimasada, demikian pula dengan kitab-kitab pandom kehidupan orang-orang Samin. Kyai Samin Surosantiko merupakan generasi Samin Anom yang melanjutkan gerakan dari sang Ayah yang disebut sebagai Samin Sepuh. Sehingga masa kepemimpinannya, ajaran Saminisme terbagai dalam dua sekte, yaitu sekte Samin Sepuh dan sekte Samin Anom. Siklus kepemimpinan ini secara mati-matian berusaha menciptakan masyarakat yang bersahaja lahir dan batin. Kyai Samin memiliki sikap puritan, dia bukanlah petani biasa, namun dia adalah cucu dari seorang pangeran. Kyai Samin adalah orang yang gigih dalam menggoreskan kalam untuk membagun insan kamil dengan latar belakang ekonomi yang mapan.

Masyarakat Samin memiliki tiga unsur gerakan Saminisme; pertama, gerakan yang mirip organisasi proletariat kuno yang menentang system feodalisme dan kolonial dengan kekuatan agraris terselubung; kedua, gerakan yang bersifat utopis tanpa perlawanan fisik yang mencolok; dan ketiga, gerakan yang berdiam diri dengan cara tidak membayar pajak, tidak menyumbangkan tenaganya untuk negeri, menjegal peraturan agraria dan pengejawantahan diri sendiri sebagai dewa suci. Menurut Kartodirjo, gerakan Samin adalah sebuah epos perjuangan rakyat yang berbentuk “kraman brandalan” sebagai suatu babak sejarah nasional, yaitu sebagai gerakan ratu adil yang menentang kekuasaan kulit putih.

Ajaran Samin bersumber dari agama Hidhu-Dharma. Beberapa sempalan ajaran Kyai Samin yang ditulis dalam bahasa jawa baru yaitu dalam bentuk puisi tradisional (tembang macapat) dan prosa (gancaran). Secara historis ajaran Samin ini berlatar dari lembah Bengawan Solo (Boyolali dan Surakarta). Ajaran Samin berhubungan dengan ajaran agama Syiwa-Budha sebagai sinkretisme antara hindhu budha. Namun pada perjalannanya ajaran di atas dipengaruhi oleh ajaran ke-Islaman yang berasal dari ajaran Syeh Siti Jenar yang di bawa oleh muridnya yaitu Ki Ageng Pengging. Sehingga patut di catat bahwa orang Samin merupakan bagian masyarakat yang berbudaya dan religius.

Daerah persebaran ajaran Samin menurut Sastroatmodjo (2003) diantaranya di Tapelan (bojonegara), Nginggil dan Klopoduwur (Blora), Kutuk (Kudus), Gunngsegara (Brebes), Kandangan (Pati), dan Tlaga Anyar (Lamongan). Ajaran di beberapa daerah ini merupakan sebuah gerakan meditasi dan mengerahkan kekuatan batiniah guna menguasai hawa nafsu.

Sebab perlawaan orang Samin sebenarnya merefleksikan kejengkelan penguasa pribumi setempat dalam menjalankan pemerintahan di Randublatung. Tindakan perlawanan ini dalam bentuk gerakan mogok membayar pajak, mengambil pohon kayu di hutan semaunya, bepergian tanpa membayar karcis kereta dan sebagainya. Perbuatan di atas membuat Belanda geram dan meyinggung banyak pihak yang menimbulkan kontradiksi yang tak kunjung padam dan membara.

Pandangan orang Samin terhadap pemimpinnya sampai saat ini masih mengakui bahwa Kyai Samin tidak pernah mati, Kyai Samin hanya mokhsa yang menjadi penghuni kaswargan. Tokoh ini dimitoskan secara fanantik, bahkan pada momentum perayaan upacara rasulan dan mauludan sebagai ajang untuk mengenang kepahlawanan Kyai Samin. Setiap pemuka masyarakat Samin selalu berbegangan sejenis primbon (kepek) yang mengatur kehidupan luas, kebijaksanaan, petunjuk dasar ketuhanan, tata pergaulan muda-mudi, remaja, dewasa dan antarwarga Samin .

Bahasa yang digunakan oleh orang Samin yaitu bahasa kawi yang ditambah dengan dialek setempat, yaitu bahasa kawi desa kasar. Orang Samin memiliki kepribadian yang polos dan jujur hal ini dapat dilihat setiap ada tamu yang datang, orang Samin selalu menyuguhkan makanan yang dimilikidan tidak pernah minyimpan makanan yang dimilikinya. Pengatahuan orang Samin terhadap rites perkawinan adalah unik, mereka menganggap bahwa dengan melalui rites perkawinan, mereka dapat belajar ilmu kasunyatan (kajian realistis) yang selalu menekankan pada dalih kemanusiaan, rasa sosial dan kekeluargaan dan tanggung jawab sosial. Orang Samin percaya dalam menuju kemajuan harus dilalui dengan marangkak lambat. Hal ini dapat dilihat dengan perilaku menolak mesin seperti traktor, huller dan lain-lain. Pakaian yang digunakan orang Samin adalah kain dengan dominasi warna hitam dengan bahan yang terbuat dari kain kasar.

Suku Samin juga mengalami perkembangan dalam hal kepercayaan dan tata cara hidup. Kawasan daerah Pati dan Brebes, terdapat sempalan Samin yang disebut Samin Jaba dan Samin Anyar yang telah meninggalkan tatacara hidup Samin dahulu. Selain itu, di Klapa Duwur (Blora) Purwosari (Cepu), dan Mentora (Tuban) dikenal wong sikep, mereka ini dulunya fanatik, tapi kini meninggalkan arahan dasar dan memilih agama formal, yakni Budha-Dharma.

Beberapa pikiran orang Samin diantaranya; menguasai adanya kekuasaan tertinggi (sang Hyang Adi budha), ramah dan belas kasih terhadap sesama mahluk, tidak terikat kepada barang-barang dunia-kegembiraan-dan kesejahteraan, serta memelihara keseimbangan batin dikalangan antar warga. Orang Samin dengan jelas mencita-citakan membangun negara asli pribumi, yang bebas dari campur tangan orang kulit putih, tiada dominasi barat satupun. Ajaran politik yang dikenakan pada suku Samin yaitu cinta dan setia kepada amanat leluhur, kearifan tua, cinta dan hormat akan pemerintahan yang dianggap sebagai orang tua dan sesepuh rohani, hormat dan setia pada dunia intelektual.

Dengan suguhan tulisan ini, diharapkan wawasan dan pengetahuan saya dan pembaca semuanya lebih terbuka serta kemudian mampu bersikap bijak dan arif dalam memandang sebuah reailtas yang ada.
Daerah penyebaran dan para pengikut ajaran Samin
Tersebar pertamakali di daerah Klopoduwur, Blora, Jawa Tengah. Pada 1890 pergerakan Samin berkembang di dua desa hutan kawasan Randublatung, Kabupaten Bojonegoro, Jawa Timur. Gerakan ini lantas dengan cepat menjalar ke desa-desa lainnya. Mulai dari pantai utara Jawa sampai ke seputar hutan di Pegunungan Kendeng Utara dan Kendeng Selatan. Atau di sekitar perbatasan provinsi Jawa Tengah dan Jawa Timur menurut peta sekarang.

Dua tempat penting dalam pergerakan Samin adalah Desa Klopodhuwur di Blora dan Desa Tapelan di Kecamatan Ngraho, Bojonegoro, yang memiliki jumlah terbanyak pengikut Samin. Mengutip karya Harry J. Benda dan Lance Castles (1960), orang Samin di Tapelan memeluk saminisme sejak tahun 1890. Dalam Encyclopaedie van Nederlandsch-Indië (1919) diterangkan, orang Samin seluruhnya berjumlah 2.300 orang (menurut Darmo Subekti dalam makalah [[Tradisi Lisan Pergerakan Samin, Legitimasi Arus Bawah Menentang Penjajah, (1999), jumlahnya 2.305 keluarga sampai tahun 1917, tersebar di Blora, Bojonegoro, Pati, Rembang, Kudus, Madiun, Sragen, dan Grobogan) dan yang terbanyak di Tapelan.

Wong Sikep
Orang-orang Samin sebenarnya kurang suka dengan sebutan “Wong Samin” sebab sebutan tersebut mengandung arti tidak terpuji yaitu dianggap sekelompok orang yang tidak mau membayar pajak, sering membantah dan menyangkal aturan yang telah ditetapkan sering keluar masuk penjara, sering mencuri kayu jati dan perkawinannya tidak dilaksanakan menurut hukum Islam. Para pengikut Saminisme lebih suka disebut “Wong Sikep“, artinya orang yang bertanggung jawab sebutan untuk orang yang berkonotasi baik dan jujur.

Konsep ajaran Samin
Pengikut ajaran Samin mempunyai lima ajaran:

Konsep Ajaran Masyarakat Samin masuk dalam kategori Budaya Masyarakat Samin : Keseimbangan , Harmonisi , Kesetaraan Keadilan. Adalah prinsip dan falsafah hidup Masy Samin tetap diyakini sampai saat ini Tahun 2006 . Dengan Tradisi Lisan menjaga Budaya dan Tradisi Lisan kepada generasi dan keturunan tingkat ke 4 adalah suatu hal yang perlu mendaatkan penelitian, yang berlanjut kepada pengakuan akan keberadaan Masayarakat Samin yang mempunyai kekhasan dalam bersikap dan bertindak. Masyarakat statis menjaga tradisi untuk kelanggengan keyakinan.

Pokok-pokok ajaran Saminisme
Pokok ajaran Samin adalah sebagai berikut:

  • Agama adalah senjata atau pegangan hidup. Paham Samin tidak membeda-bedakan agama, oleh karena itu orang Samin tidak pernah mengingkari atau membenci agama. Yang penting adalah tabiat dlam hidupnya.
  • Jangan mengganggu orang, jangan bertengkar, jangan suka irihati dan jangan suka mengambil milik orang.
  • Bersikap sabar dan jangan sombong.
  • Manusia hidup harus memahami kehidupannya sebab hidup adalah sama dengan roh dan hanya satu dibawa abadi selamanya.Menurut orang Samin, roh orang yang meninggal tidaklah meninggal, namun hanya menanggalkan pakaiannya.
  • Bila berbicara harus bisa menjaga mulut, jujur dan saling menghormati. Berdagang bagi orang Samin dilarang karena dalam perdagangan ada unsur “ketidakjujuran”. Juga tidak boleh menerima sumbangan dalam bentuk uang.

Kitab Suci Orang Samin
Sebagaimana paham lain yang dianggap oleh pendukungnya sebagai agama, orang Samin juga memiliki “kitab suci”. “Kitab suci“‘ itu adalah Serat Jamus Kalimasada yang terdiri atas beberapa buku, antara lain Serat Punjer Kawitan, Serat Pikukuh Kasajaten, Serat Uri-uri Pambudi, Serat Jati Sawit, Serat Lampahing Urip, dan merupakan nama-nama kitab yang amat populer dan dimuliakan oleh orang Samin.

Ajaran dalam buku Serat Pikukuh Kasajaten (pengukuhan kehidupan sejati) ditulis dalam bentuk puisi tembang, yaitu suatu genre puisi tradisional kesusasteraan Jawa.

Dengan mempedomani kitab itulah, orang Samin hendak membangun sebuah negara batin yang jauh dari sikap drengki srei, tukar padu, dahpen kemeren. Sebaliknya, mereka hendak mewujudkan perintah “Lakonana sabar trokal. Sabare dieling-eling. Trokali dilakoni.”

Riwayat Hidup Samin
Samin Surosentiko lahir pada 1859 dengan nama Raden Kohar di Desa Ploso Kedhiren, Randublatung Kabupaten Blora. Ayahnya bernama Raden Surowijaya atau Samin Sepuh. Ia mengubah namanya menjadi Samin Surosentiko sebab Samin adalah sebuah nama yang bernafas wong cilik. Samin Surosentiko masih mempunyai pertalian darah dengan Kyai Keti di Rajegwesi, Bojonegoro dan Pangeran Kusumoningayu yang berkuasa di Kabupaten Sumoroto ( kini menjadi daerah kecil di Kabupaten Tulungagung) pada 1802-1826.

Pada 1890 Samin Surosentiko mulai mengembangkan ajarannya di daerah Klopoduwur, Blora. Banyak yang tertarik dan dalam waktu singkat sudah banyak orang menjadi pengikutnya. Saat itu pemerintah Kolonial Belanda menganggap sepi ajaran tersebut. Cuma dianggap sebagai ajaran kebatinan atau agama baru yang remeh temeh belaka.

Pada 1903 residen Rembang melaporkan terdapat 722 orang pengikut Samin yang tersebar di 34 desa di Blora bagian selatan dan Bojonegoro. Mereka giat mengembangkan ajaran Samin. Pada 1907, pengikut Samin sudah berjumlah sekitar 5000 orang. Pemerintah mulai merasa was-was sehingga banyak pengikut Samin yang ditangkap dan dipenjarakan.

Pada 8 November 1907, Samin Surosentiko diangkat oleh pengikutnya sebagai Ratu Adil dengan gelar Prabu Panembahan Suryangalam. Kemudian 40 hari sesudah menjadi Ratu Adil itu, Samin Surosentiko ditangkap oleh asisten Wedana Randublatung, Raden Pranolo. Beserta delapan pengikutnya, Samin lalu dibuang ke luar Jawa (ke kota Padang, Sumatra Barat), dan meninggal di Padang pada 1914.

Tahun 1908, Penangkapan Samin Surosentiko tidak memadamkan gerakan Samin. Pada 1908, Wongsorejo, salah satu pengikut Samin, menyebarkan ajarannya di Madiun, mengajak orang-orang desa untuk tidak membayar pajak kepada pemerintah. Wongsorejo dengan sejumlah pengikutnya ditangkap dan dibuang keluar Jawa.

Pada 1911 Surohidin, menantu Samin Surosentiko dan Engkrak salah satu pengikutnya menyebarkan ajaran Samin di Grobogan. Karsiyah menyebarkan ajaran Samin di kawasan Kajen, Pati. Perkembangannya kemudian tidak jelas.

Tahun 1912, pengikut Samin mencoba menyebarkan ajarannya di daerah Jatirogo, Kabupaten Tuban, namun gagal.

Puncak penyebaran gerakan Samin terjadi pada 1914. Pemerintah Belanda menaikkan pajak. Disambut oleh para pengikut Samin dengan pembangkangan dan penolakan dengan cara-cara unik. Misalnya, dengan cara menunjukkan uang pada petugas pajak, “Iki duwite sopo?” (bahasa Jawa: Ini uangnya siapa?), dan ketika sang petugas menjawab, “Yo duwitmu” (bahasa Jawa: Ya uang kamu), maka pengikut Samin akan segera memasukkan uang itu ke sakunya sendiri. Singkat kata, orang-orang Samin misalnya di daerah Purwodadi dan di Balerejo, Madiun, sudah tidak lagi menghormati pamong Desa, polisi, dan aparat pemerintah yang lain.

Dalam masa itu, di Kajen Pati, Karsiyah tampil sebagai Pangeran Sendang Janur, mengimbau kepada masyarakat untuk tidak membayar pajak. Di Desa Larangan, Pati orang-orang Samin juga mengejek dan memandang para aparat desa dan polisi sebagai badut-badut belaka.

Di Desa Tapelan, Bojonegoro juga terjadi perlawanan terhadap pemerintah, dengan tidak mau membayar pajak. Karena itu, teror dan penangkapan makin gencar dilakukan pemerintah Belanda terhadap para pengikut Samin.

Pada tahun 1914 ini akhirnya Samin meninggal dalam pengasingannya di Sumatra Barat. Namun teror terus dilanjutkan oleh pemerintah Belanda terhadap pengikut Samin. Akibat teror ini, sekitar tahun 1930-an, perlawanan gerakan Samin terhadap pemerintah kolonial menguap dan terhenti.
Sikap Orang Samin
Walaupun masa penjajahan Belanda dan Jepang telah berakhir, orang Samin tetap menilai pemerintah Indonesia saat itu tidak jujur. oleh karenanya, ketika menikah, mereka tidak mencatatkan dirinya baik di Kantor Urusan Agama/(KUA) atau di catatan sipil.
Secara umum, perilaku orang Samin/ ‘Sikep’ sangat jujur dan polos tetapi kritis.

Bahasa Orang Samin
Mereka tidak mengenal tingkatan bahasa Jawa, jadi bahasa yang dipakai adalah bahasa Jawa ngoko. Bagi mereka menghormati orang lain tidak dari bahasa yang digunakan tapi sikap dan perbuatan yang ditunjukkan.

Pakaian Orang Samin
Pakaian orang Samin biasanya terdiri baju lengan panjang tidak memakai krah, berwarna hitam. Laki-laki memakai ikat kepala. Untuk pakaian wanita bentuknya kebaya lengan panjang, berkain sebatas di bawah tempurung lutut atau di atas mata kaki.
Sistem kekerabatan
Dalam hal kekerabatan masyarakat Samin memiliki persamaan dengan dengan kekerabatan Jawa pada umumnya. Sebutan-sebutan dan cara penyebutannya sama. Hanya saja mereka tidak terlalu mengenal hubungan darah atau generasi lebih ke atas setelah Kakek atau Nenek.

Hubungan ketetanggaan baik sesama Samin maupun masyarakat di luar Samin terjalin dengan baik. Dalam menjaga dan melestarikan hubungan kekerabatan masyarakat Samin memiliki tradisi untuk saling berkunjung terutama pada saat satu keluarga mempunyai hajat sekalipun tempat tinggalnya jauh.
Pernikahan bagi orang Samin
Menurut Samin, perkawinan itu sangat penting. Dalam ajarannya perkawinan itu merupakan alat untuk meraih keluhuran budi yang seterusnya untuk menciptakan “Atmaja (U)Tama” (anak yang mulia).

Dalam ajaran Samin , dalam perkawinan seorang pengantin laki-laki diharuskan mengucapkan syahadat, yang berbunyi kurang lebih demikian : ” Sejak Nabi Adam pekerjaan saya memang kawin. (Kali ini) mengawini seorang perempuan bernama…… Saya berjanji setia kepadanya. Hidup bersama telah kami jalani berdua.”

Demikian beberapa ajaran kepercayaan yang diajarkan Samin Surosentiko pada pengikutnya yang sampai sekarang masih dipatuhi warga samin.

Menurut orang Samin perkawinan sudah dianggap sah walaupun yang menikahkan hanya orang tua pengantin.

Ajaran perihal Perkawinan dalam tembang Pangkur orang Samin adalah sebagai berikut (dalam Bahasa Jawa):

Basa Jawa

Terjemahan

Saha malih dadya garan, “Maka yang dijadikan pedoman,
anggegulang gelunganing pembudi, untuk melatih budi yang ditata,
palakrama nguwoh mangun, pernikahan yang berhasilkan bentuk,
memangun traping widya, membangun penerapan ilmu,
kasampar kasandhung dugi prayogântuk, terserempet, tersandung sampai kebajikan yang dicapai,
ambudya atmaja ‘tama, bercita-cita menjadi anak yang mulia,
mugi-mugi dadi kanthi. mudah-mudahan menjadi tuntunan.”

Sikap terhadap lingkungan
Pandangan masyarakat Samin terhadap lingkungan sangat positif, mereka memanfaatkan alam (misalnya mengambil kayu) secukupnya saja dan tidak pernah mengeksploitasi. Hal ini sesuai dengan pikiran masyarakat Samin yang cukup sederhana, tidak berlebihan dan apa adanya. Tanah bagi mereka ibarat ibu sendiri, artinya tanah memberi penghidupan kepada mereka. Sebagai petani tradisional maka tanah mereka perlakukan sebaik-baiknya.Dalam pengolahan lahan (tumbuhan apa yang akan ditanam) mereka hanya berdasarkan musim saja yaitu penghujan dan kemarau. Masyarakat Samin menyadari isi dan kekayaan alam habis atau tidak tergantung pada pemakainya.

Pemukiman
Pemukiman masyarakat Samin biasanya mengelompok dalam satu deretan rumah-rumah agar memudahkan untuk berkomunikasi. Rumah tersebut terbuat dari kayu terutama kayu jati dan juga bambu, jarang ditemui rumah berdinding batu bata. Bangunan rumah relatif luas dengan bentuk limasan, kampung atau joglo. Penataan ruangnya sangat sederhana dan masih tradisional terdiri ruang tamu yng cukup luas, kamar tidur dan dapur. Kamar mandi dan sumur terletak agak jauh dan biasanya digunakan beberapa keluarga. Kandang ternak berada di luar di samping rumah.

Upacara dan tradisi
Upacara-upacara tradisi yang ada pada masyarakat Samin antara lain nyadran (bersih desa) sekaligus menguras sumber air pada sebuah sumur tua yang banyak memberi manfaat pada masyarakat. Tradisi selamatan yang berkaitan dengan daur hidup yaitu kehamilan, kelahiran, khitanan, perkawinan dan kematian. Mereka melakukan tradisi tersebut secara sederhana.

Masyarakat Samin saat ini
Sekalipun masyarakat Samin berusaha mempertahankan tradisi namun tidak urung pengaruh kemajuan zaman juga mempengaruhi mereka. Misalnya pemakaian traktor dan pupuk kimiawi dalam pertanian, alat-alat rumah tangga dari plastik, aluminium dan lain nya. Yang diharapkan tidak hilang terpupus zaman adalah nilai-nilai positif atau kearifan lokal yang telah ada pada masyarakat Samin tersebut, misal kejujuran dan kearifannya dalam memakai alam, semangat gotong royong dan saling menolong yang masih tinggi.

Referensi

  • Judul Buku : Kearifan Lokal di Lingkungan Masyarakat Samin kabupaten Blora Jawa Tengah
  • Penulis : Dra. Titi Mumfangati, dkk
  • Penerbit : Jarahnitra, 2004, Yogyakarta
  • Halaman : xiii + 164

Sumber: http://id.wikipedia.org/wiki/Ajaran_Samin

Read Full Post »

budayaBertepatan dengan momentum Kebangkitan Nasional 2009, domain sawali.us akhirnya saya ubah judul dan deskripsinya. Jujur saja, saya masih kurang sreg dengan titel “Meniti Pelangi” dan deskripsi “Menatap Matahari” yang sebelumnya saya gunakan. Saya sendiri tak paham benar, mengapa saya menggunakan judul dan tagline semacam itu sejak domain ini saya luncurkan. Ada kesan, antara judul dan tagline-nya tidak nyambung, bahkan sama-sama mengesankan sebagai sebuah judul blog. Oleh karena itu, saya memutuskan untuk mengubah judul tersebut menjadi “Pelangi Budaya Indonesia” dengan tagline “Perekat Kesenjangan Lintasbudaya”.

Hingga saat ini, saya masih mengelola tiga blog pribadi. Selain blog ini, juga ada sawali.info dan sawali.co.cc. Sawali.info memang saya khususkan sebagai media untuk membuat catatan ringan tentang persoalan-persoalan pendidikan, bahasa, dan sastra, sedangkan sawali.co.cc saya khususkan untuk menampung berbagai catatan yang berkaitan dengan bahasa dan sastra. Dalam keadaan seperti itu, saya seringkali bingung ketika harus membuat postingan di blog sawali.us. Seringkali, saya tak sanggup menghindari ide-ide kembar, sehingga muncul kesan domain sawali.us tak jauh berbeda dengan sawali.info.

Agar sedikit “tampil beda”, maka sejak titel dan tagline blog ini berubah, saya ingin menggunakan domain ini secara khusus untuk menampung berbagai tulisan yang berkaitan dengan persoalan-persoalan budaya Indonesia. Sebagai blog budaya, tentu saja pikiran awam saya mustahil mampu menjangkau serba-serbi budaya Indonesia yang berwarna “pelangi”. Oleh karena itu, sesekali saya perlu memperkaya isi postingan ini dengan manfaatkan link yang saya peroleh dari blog atau web lain yang berkaitan dengan misi blog. Tentu saja, saya tidak akan meninggalkan kaidah atau etika yang berlaku dalam dunia kepenulisan, sehingga tulisan yang saya salin dari blog atau web lain tetap akan saya cantumkan sumbernya.

Tentu saja, saya tak bermaksud menjadikan blog ini sebagai media yang mampu menjadi perekat kesenjangan lintabudaya dalam arti yang sesungguhnya. Saya hanya sekadar ingin memberikan sebuah “kesaksian”, membuat catatan-catatan kecil, merenungi dan merefleksikannya, hingga akhirnya bisa membuat pikiran-pikiran saya menjadi lebih terbuka terhadap kenyataan Indonesia yang multikultur. Dengan cara demikian, setidaknya, saya tidak akan ikut-ikutan terjebak dalam pemikiran-pemikiran primordial yang sempit yang memosisikan satu budaya dan budaya lainnya dalam aras superior-inverior, mayoritas-minoritas, atau dominan-marginal.

Terima kasih dan salam budaya!

Read Full Post »

gedung dprMenjelang pesta Pemilu, jagad politik Indonesia makin gegap-gempita dengan munculnya banyak caleg dari kalangan artis. Setiap parpol peserta Pemilu seperti berlomba untuk merekrut artis guna memperkuat barisan caleg. Tujuannya? Bisa jadi untuk menciptakan imaji popularitas di tengah publik. Dengan munculnya kalangan artis, parpol yang mereka usung jadi lebih dikenal dan harapan untuk mendulang suara akan lebih menjanjikan.

Adakah yang salah? Saya kira tidak! Setiap parpol punya hak dan wewenang untuk merekrut siapa saja caleg yang dinilai layak untuk memperkuat barisan politik, termasuk dari kalangan artis. Tentu saja dengan syarat, para elite parpol tetap memiliki fatsun politik dan sanggup memenuhi aturan main yang ada; tidak asal main comot, apalagi hanya sekadar numpang tenar dari artis yang bersangkutan.

Salah jugakah kalau para artis kepencut untuk ikut bermain dalam ranah politik? Saya kira tidak juga. Setiap warga negara –sesuai dengan ketentuan yang berlaku—berhak untuk berpolitik. Parpol mana yang akan dimasuki juga termasuk bagian dari persoalan personal yang tidak bisa diintervensi pihak mana pun.

Yang jadi persoalan, apakah kehadiran artis dalam jajaran parlemen, kalau kelak mereka memang dipilih oleh rakyat, sanggup melakukan perubahan? Sanggupkah mereka meninggalkan pola dan gaya hidup seleb yang selama ini telah mereka nikmati setelah malang-melintang di dunia selebritis? Pertanyaan ini penting dan relevan untuk dijawab, sebab menjadi wakil rakyat tidak sama dan sebangun dengan wilayah keartisan yang selama ini mereka arungi. Kalau selama menjadi artis, mereka bebas melakukan apa saja, tanpa ada beban diawasi oleh konstituennya. Setelah jadi wakil rakyat? Tentu saja mereka tak bisa berbuat semau gue. Rakyat yang telah memilihnya dipastikan akan selalu mengontrol dan mengawasi sepak-terjang kinerja mereka. Ini artinya, perlu ada perubahan gaya dan pola hidup wakil rakyat dari kalangan artis sebelum mereka melakukan perubahan di negeri ini.

Pengalaman selama ini menunjukkan bahwa menjadi wakil rakyat tidak dijadikan sebagai sarana untuk mencapai tujuan nasional, tetapi justru menjadi tujuan itu sendiri. Kalau ini yang terjadi, sungguh repot. Berapa persenkah wakil rakyat kita yang menjadikan kursi parlemen yang mereka duduki sebagai sarana untuk mencapai tujuan?

Yang sering terjadi, justru seperti apa yang pernah disitir oleh Lord Acton bahwa kekuasaan itu cenderung korup. Para wakil rakyat kita justru banyak yang tersandung masalah hukum akibat tak sanggup menahan naluri ”kekuasaan” dengan melakukan tindakan yang berlawanan secara diametral dengan kehendak rakyat.

Kita berharap, kehadiran artis dalam jagad perpolitikan kita bisa menjadi pioner untuk melakukan sebuah perubahan terhadap nasib rakyat yang selama ini masih terabaikan. Rakyat hanya disanjung-puji saat kampanye. Selebihnya, rakyat hanya menjadi objek yang terus terpinggirkan dari masa ke masa. Meski demikian, perubahan juga tidak cukup dilakukan oleh wakil rakyat dari kalangan artis. Semua wakil rakyat yang telah dipercaya untuk mengemban amanat perlu melakukan perjuangan secara kolektif untuk menjadikan rakyat sebagai subjek. ***

Read Full Post »

thumbnailSalah satu daya tarik sebuah blog adalah tampilan alias theme. Trend tampilan halaman depan sebuah blog belakangan ini adalah format majalah dengan menampilkan thumnail (image) di bawah judul. Salah satu theme blog yang memiliki ciri khas format majalah pada halaman depan adalah theme revolution karya desainer Bryan Gardner. Dengan tampilan wajah seperti itu, halaman depan blog menjadi lebih menarik.

Selain kode bawaan dari theme tertentu, kita juga bisa membuat tampilan blog kita seperti dalam format majalah dengan memodifikasinya. Berikut ini adalah kode untuk menampilkan thumbnail pada halaman depan, khususnya untuk engine wordpress dengan domain sendiri.

<?php

if (have_posts()) : $count = 0;

while(have_posts()) : the_post();

$count++;

if ($count>2) break;

?>

<?php $postimageurl = get_post_meta($post->ID, ‘image’, true); if ($postimageurl) { ?>

<p style=”font-size:13px; font-family:georgia;font-weight:bold;margin:0px;text-align:left;”><a href=”<?php the_permalink() ?>” rel=”bookmark” title=”Permanent Link to <?php the_title_attribute(); ?>”><?php the_title(); ?></a></p>

<p style=”font-size:11px; font-family:arial;margin:0px 5px 5px 8px;”>

<?php the_time(‘j F Y’) ?> | <?php if(function_exists(‘the_views’)) { the_views(); } ?> | <a href=”<?php comments_link(); ?>”><?php comments_number(’0 respon’, ’1 respon’, ‘% respon’); ?></a> <?php edit_post_link(‘(e)’, ”, ”); ?></span></p></div>

<div style=”border-bottom:1px dotted #94B1DF; margin-bottom:5px; padding:0px 0px 5px 0px; clear:both;”></div>

<a href=”<?php the_permalink() ?>” rel=”bookmark”>

<img style=”float:left;width:100px;height:98px;border:3px solid #eee;margin:3px 5px 0px 0px;” src=”<?php echo $postimageurl; ?>” alt=”img” /></a><?php } ?><?php the_content_limit(300); ?>

<div style=”border-bottom:1px dotted #94B1DF; margin-bottom:10px; padding:0px 0px 10px 0px; clear:both;”></div><?php endwhile; endif; ?>

Keterangan:

  1. Kode tersebut digunakan untuk mengganti kode asli yang terdapat pada file index.php pada theme yang kita gunakan. (Silakan cari pada theme editor!) Sebelum diganti, kode asli sebaiknya di-back-up dulu. Hal ini dimaksudkan untuk berjaga-jaga apabila terjadi error.
  2. Angka 2 pada kode if ($count>2) break; menyatakan jumlah postingan yang akan ditampilkan di halaman depan. Angka 2 bisa diganti sesuai selera kita. Sedangkan, angka 300 pada kode <?php the_content_limit(300); ?> menunjukkan jumlah karakter yang akan ditampilkan pada setiap postingan. Kita juga bisa mengganti angka tersebut sesuai panjang pendeknya penggalan postingan yang akan ditampilkan.
  3. Jangan lupa, ketika kita memosting tulisan, masukkan link image (gambar) yang kita upload pada value dan klik atau ketik image pada kolom nama pada fitur Add new custom field: yang terdapat di bawah text-editor. Kemudian, klik add custom field.

customfiled

Nah, selamat mencoba, semoga berhasil! Salam ngeblog! ***

Read Full Post »

bahasa ibuUNESCO telah menetapkan 21 Februari sebagai Hari Bahasa Ibu Internasional. Pencanangan tersebut diwujudkan dalam bentuk Monumen Martir (Shaheed Minar) di Kampus Universitas Dhaka sebagai bentuk apresiasi terhadap pengorbanan bahasa Bangla, 21 Februari 1952. Sebagai bagian dari masyarakat dunia yang memiliki banyak bahasa Ibu (bahasa daerah), mau atau tidak, bangsa kita perlu melakukan upaya refleksi dan re-evaluasi terhadap keberadaan bahasa Ibu.

Dengan nada sedih, harus kita katakan bahwa keberadaan bahasa Ibu di sebuah negeri yang multietnik dan diglosia seperti di negara kita, nyaris terpinggirkan. Keterpukauan dan euforia globalisasi, disadari atau tidak, telah menumbuhkan sikap apatis terhadap upaya pelestarian dan pengembangan bahasa Ibu. Bangsa kita terlalu silau untuk melihat semua yang berbau global sebagai trend dunia yang mesti dianut. Banyak di antara kita yang lupa, bahwa bangsa kta memiliki banyak nilai kearifan lokal yang luput digali dan dikembangkan lebih jauh menjadi aset budaya bangsa yang agung dan adiluhung.

Berkaitan dengan Hari Bahasa Ibu Internasional, agaknya perlu ada pemikiran ulang untuk benar-benar menjadikan bahasa Ibu sebagai ikon pemerkaya khazanah budaya bangsa sehingga bangsa kita tak kehilangan kesejatian diri sebagai bangsa yang multikultur dan multietnik. Keterpukauan terhadap globalisasi juga telah menumbuhkan sikap latah dengan mengagungkan penggunaan bahasa asing secara berlebihan. Yang lebih menyedihkan, justru ada upaya sistematis untuk meminggirkan peran bahasa Ibu. Hal itu terjadi dengan munculnya institusi pendidikan yang di-setting dengan menggunakan bahasa asing (baca: Inggris) sebagai bahasa pengantarnya.

Kita tidak antibahasa asing. Justru kita perlu bersikap lentur dan luwes dalam menerima pengaruh bahasa dan kosakata asing sebagai upaya untuk memperkaya bahasa Indonesia sebagai bahasa nasional sekaligus sebagai bahasa resmi. Meski demikian, pengabaian terhadap keberadaan bahasa Ibu, sungguh sebuah langkah keliru. Dunia pendidikan yang notabene menjadi agen kebudayaan, perlu menjadi pionir bagaimana seharusnya bersikap dalam menghadapi gencarnya gerusan serta penetrasi budaya asing.

Senyampamg belum telanjur punah, kini sudah saatnya ada kesadaran kolektif bangsa untuk kembali menghidupkan bahasa Ibu sebagai bahasa komunikasi dalam lingkungan keluarga dan di aras lokal. Kesadaran kolektif ini perlu ditindaklanjuti melalui aksi nyata dengan memasukkan bahasa Ibu sebagai bagian kurikulum pendidikan. Tanpa ada upaya serius merevitalisasi bahasa Ibu, maka kepunahan bahasa yang sarat dengan nilai-nilai kearifan lokal itu hanya tinggal menunggu waktu. Relakah bahasa Ibu kita mengalami nasib merana hingga akhirnya tak lagi dikenang dan digunakan sebagai bahasa pergaulan dalam konteks komunikasi.

Sungguh, kita akan benar-benar meratap dan berduka seandainya dalam beberapa generasi mendatang, bekas kejayaan bahasa Ibu itu sudah tak lagi terlacak jejaknya.

Read Full Post »

Pk SholehSudah lama banget sebenarnya saya ingin bertemu darat dengan Pak Ahmad Sholeh. Ketika masih bertugas di Kudus, Jawa Tengah, saya sudah sering mendengar kabar dari Pak Marsudiyanto bahwa Pak Sholeh pernah tinggal di Kendal karena kebetulan saja istrinya berasal dari Kendal. Keinginan saya untuk bisa bertemu dengan Pak Sholeh makin kuat ketika dalam sebuah komentarnya, beliau menyatakan bahwa dia sesungguhnya berasal dari desa Sambung, Kecamatan Godong, Kabupaten Grobogan. Saya terkejut, sebab setiap kali mudik lewat jalan pintas, saya selalu melintasi desa ini.

Keinginan saya itu terkabulkan sudah pada Selasa, 3 Februari 2009 yang lalu. HP saya tiba-tiba berdering dengan nomor HP yang belum ada ID-nya. Ketika saya sapa, ternyata Pak Ahmad Sholeh yang saat itu sudah berada di sekolah, tempat saya mengajar. Hari Selasa kebetulan saya tidak datang ke sekolah karena bersamaan dengan hari MGMP. Nah, ternyata Pak Sholeh juga ingin bertemu darat dengan saya. Duh, alangkah senangnya. Pak Sholeh yang mungkin sudah sangat hafal dengan daerah Kendal, beliau langsung menyatakan keinginan untu bersilaturahmi ke rumah.

Tak lama kemudian, Pak Sholeh benar-benar datang ke rumah bersama seorang teman kerjanya. Suasana pun langsung cair, seperti saudara yang sudah lama tak bertemu. Obrolan terus mengalir berganti-ganti topik, mulai soal kampung halaman, keluarga, blog, dunia perbukuan – topik ini yang paling banyak dibicarakan–, hingga soal domain. Kabarnya, Pak Sholeh baru aja mendapatkan domain baru atas jasa baik Gus Yehia. Wah selamat, Pak Sholeh, atas domain barunya.

Nah, yang lebih mengejutkan, ternyata Pak Sholeh telah pindah tugas di Semarang dan tinggal di Kendal. Kebetulan juga, rumah yang beliau tempati bersama keluarga tercinta tak jauh-jauh amat dari rumah saya. Wah, bisa sering-sering ketemu nih, Pak.

Terima kasih atas silaturahminya, Pak. Mohon maaf jika kami hanya bisa memberikan sambutan ala kadarnya. Semoga saja kita bisa sering bersilaturahmi, sehingga bisa makin memantabkan langkah bloger Kendal yang diusulkan Mas Andy MSE agar segera membentuk Komunitas Bloger Kendal. Akhirnya, terkabulkan sudah keinginan saya itu. ***

Read Full Post »

tpcSungguh, saya terharu ketika dikontak Pak Gempur, Minggu sore, 25 Januari yang lalu. Masih berada di wilayah Gunung Kelir dalam rangkaian “Ziarah Wali Bloger Timur-Tengah”, beliau menyampaikan keinginan mengajak teman-teman dari TPC Surabaya untuk bersilaturahmi ke rumah. Wah, tentu saja keinginan teman-teman TPC itu langsung saya sambut dengan senang hati. Saya pun tak sabar menanti kehadiran rombongan sahabat yang selama ini sebagian besar baru saya kenal lewat dunia maya itu. Kontak via HP terus saya lakukan.

Di tengah guyuran hujan, pukul 21.00 WIB saya siap menjemput Pak Gempur, dkk. di tempat yang telah kami sepakati. Agak lama saya menunggu mobil “peziarah” yang melintas. Namun, lantaran hujan dan remang-remang, mata saya tak sanggup memastikan mobil rombongan yang melintas. Perasaan saya baru tenang setelah dikontak Pak Gempur. Walah, ternyata mobil rombongan sudah parkir di depan kantor Polres Kendal. Tanpa basa-basi, mereka segera saya ajak membuntuti saya menuju ke gubug. Alhamdulillah, seperti mimpi, rombongan sahabat TPC itu akhirnya tiba juga.

tpc2Karena kami memang keluarga sederhana, tak banyak suguhan yang bisa saya sajikan untuk sahabat-sahabat bloger itu. Silaturahmi itu benar-benar merupakan sebuah kehormatan buat kami sekeluarga. Dalam cuaca selama perjalanan ziarah, mereka tak menyurutkan langkahnya untuk mampir ke gubug saya yang sumpek. Maka, setelah saling “tabur pesona”, obrolan pun tumpah. Perbincangan seputar dunia bloging, engine blog, perjalanan selama ziarah, dan berbagai obrolan lain.

Setidaknya, ada 15 sahabat bloger TPC yang berkenan hadir. Berikut ini daftarnya! (Mohon maaf jika ada yang salah sebut nama dan link-nya.)

  1. Fayyas
  2. Udin
  3. Pandu Gilas A
  4. Arul
  5. Anang
  6. Dior/Diorockout
  7. Dias/Dedi
  8. Frenavit Putra
  9. Ardyansah
  10. Andy MSE
  11. A. Ghofur
  12. Fithra
  13. K.u.c.l.u.k
  14. Novianto
  15. Mieznk

Sahabat-sahabat bloger itu saya sarankan untuk bermalam saja di gubug kami. Namun, lantaran perjalanan panjang itu masih terus berlanjut, kami tak kuasa mencegahnya. Mereka telah ditunggu sahabat-sahabat Loenpia.net yang juga telah menanti. Mereka pun segera meninggalkan gubug kami sekiar pukul 23.00 WIB di tengah guyuran hujan yang juga belum mereda. Saya dan istri hanya bisa melepas kepulangan mereka dengan doa, semoga perjalanan ziarah itu berlangsung lancar, sukses, dan selamat.

Sekali lagi kami sekeluarga mengucapkan terima kasih dan mohon maaf jika hanya bisa memberikan sambutan ala kadarnya. Semoga pertemuan dan silaturahmi semacam ini masih terus berlanjut pada waktu-waktu mendatang. Bravo TPC, selamat atas suksesnya perjalanan ziarah bloger Timur-Tengah. ***

Read Full Post »

Older Posts »

Ikuti

Get every new post delivered to your Inbox.